Quinoline-N-oxide hydrate
Catalog Number:
(10207-104)
Supplier:
Boster Biological Technology
Description:
Rabbit IgG polyclonal antibody for Serine/threonine-protein kinase Chk2(CHEK2) detection. Tested with WB in Human;Mouse;Rat.
Catalog Number:
(10209-678)
Supplier:
Boster Biological Technology
Description:
Rabbit IgG polyclonal antibody for Ras-related protein Rab-3C(RAB3C) detection. Tested with WB in Human;Mouse;Rat.
Supplier:
Shenandoah Biotechnology
Description:
Epithelial-derived neutrophil-activating peptide 78 (ENA 78), also known as CXCL5, is a chemokine that recruits neutrophils, promotes angiogenesis, and stimulates connective tissue remodelling. ENA 78 production is stimulated by interleukin 1 (IL-1) or tumor necrosis factor alpha (TNFα), and signals through the chemokine receptor CXCR2. ENA 78, 5-78aa is one of three naturally occuring ENA 78 variants in which the N-terminus has been truncated.
Catalog Number:
(10206-854)
Supplier:
Boster Biological Technology
Description:
Rabbit IgG polyclonal antibody for Myc proto-oncogene protein(MYC) detection. Tested with WB in Human;Mouse;Rat.
Catalog Number:
(103006-440)
Supplier:
Anaspec Inc
Description:
This peptide is from amino acid 3-42 of the full length 42-amino acid long GIP (Glucose-dependent Insulinotropic Polypeptide or also known as Gastric Inhibitory Polypeptide). The in-vivo degradation of the first two N-terminal amino acids (Tyr-Ala) by the enzyme dipeptidyl peptidase IV (DPP IV) results in making GIP (3-42) a potent antagonist as opposed to the agonist full length GIP on the GIP receptor.
Sequence: EGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ MW: 4759.4 Da % Peak area by HPLC: 95 Storage condition: -20° C
Catalog Number:
(10068-492)
Supplier:
Prosci
Description:
Kinase subunit of both mTORC1 and mTORC2, which regulate cell growth and survival in response to nutrient and hormonal signals. mTORC1 is activated in response to growth factors or amino-acids. Amino-acid-signaling to mTORC1 is mediated by Rag GTPases, which cause amino-acid-induced relocalization of mTOR within the endomembrane system. Growth factor-stimulated mTORC1 activation involves AKT1-mediated phosphorylation of TSC1-TSC2, which leads to the activation of the RHEB GTPase that potently activates the protein kinase activity of mTORC1. Activated mTORC1 up-regulates protein synthesis by phosphorylating key regulators of mRNA translation and ribosome synthesis. mTORC1 phosphorylates EIF4EBP1 and releases it from inhibiting the elongation initiation factor 4E (eiF4E). mTORC1 phosphorylates and activates S6K1 at 'Thr-421', which then promotes protein synthesis by phosphorylating PDCD4 and targeting it for degradation. mTORC2 is also activated by growth factors, but seems to be nutrient-insensitive. mTORC2 seems to function upstream of Rho GTPases to regulate the actin cytoskeleton, probably by activating one or more Rho-type guanine nucleotide exchange factors. mTORC2 promotes the serum-induced formation of stress-fibers or F-actin. mTORC2 plays a critical role in AKT1 'Ser-473' phosphorylation, which may facilitate the phosphorylation of the activation loop of AKT1 on 'Thr-308' by PDK1 which is a prerequisite for full activation. mTORC2 regulates the phosphorylation of SGK1 at 'Ser-422'. mTORC2 also modulates the phosphorylation of PRKCA on 'Ser-657'.
Catalog Number:
(10207-206)
Supplier:
Boster Biological Technology
Description:
Rabbit IgG polyclonal antibody for Multidrug resistance-associated protein 1(ABCC1) detection. Tested with WB, IHC-P in Human;Mouse;Rat.
Catalog Number:
(103006-594)
Supplier:
Anaspec Inc
Description:
This peptide is amino acids 17 to 26 fragment of p53, the Mdm-2 binding domain of p53 known also as p53N. This sequence contains all of the residues that contact the binding domain of Mdm-2. The tumor suppressor protein p53 is important in maintaining genome stability and in preventing cancer development.
Sequence:ETFSDLWKLL MW:1251.5 Da % peak area by HPLC:95 Storage condition:-20° C
Catalog Number:
(10208-848)
Supplier:
Boster Biological Technology
Description:
Rabbit IgG polyclonal antibody for BH3-interacting domain death agonist(Bid) detection. Tested with WB, IHC-P in Mouse;Rat.
Catalog Number:
(10206-776)
Supplier:
Boster Biological Technology
Description:
Rabbit IgG polyclonal antibody for Metalloproteinase inhibitor 3(TIMP3) detection. Tested with WB, ELISA in Human;Mouse;Rat.
Catalog Number:
(10207-080)
Supplier:
Boster Biological Technology
Description:
Rabbit IgG polyclonal antibody for Phosphomevalonate kinase(PMVK) detection. Tested with WB, IHC-P in Human;Mouse;Rat.
Catalog Number:
(10206-962)
Supplier:
Boster Biological Technology
Description:
Rabbit IgG polyclonal antibody for TNF receptor-associated factor 2(TRAF2) detection. Tested with WB, IHC-P in Human;Mouse;Rat.
Catalog Number:
(10748-668)
Supplier:
Prosci
Description:
ORAI3 Antibody: Antigen stimulation of immune cells triggers Ca++ entry through Ca++ release-activated Ca++ (CRAC) channels. ORAI3 is one of two mammalian homologs to ORAI1, a recently identified four-transmembrane spanning protein that is an essential component of CRAC. All three homologs have been shown to function as Ca++ plasma membrane channels gated through interactions with STIM1, the store-activated endoplasmic reticulum Ca++ sensor. However, ORAI3 channels failed to produce detectable Ca++ selective currents in cells co-transfected with ORAI3 and STIM1, indicating that ORAI3 channels undergo a lesser degree of depotentiation than ORAI1 or ORAI2. Na+ currents through ORAI1, 2 and 3 channels were equally inhibited by extracellular Ca++, indicating that each have similar affinities for Ca++ within the selectivity filter.
Catalog Number:
(76011-464)
Supplier:
Prosci
Description:
This gene is a member of the protocadherin beta gene cluster, one of three related gene clusters tandemly linked on chromosome five. The gene clusters demonstrate an unusual genomic organization similar to that of B-cell and T-cell receptor gene clusters. The beta cluster contains 16 genes and 3 pseudogenes, each encoding 6 extracellular cadherin domains and a cytoplasmic tail that deviates from others in the cadherin superfamily. The extracellular domains interact in a homophilic manner to specify differential cell-cell connections. Unlike the alpha and gamma clusters, the transcripts from these genes are made up of only one large exon, not sharing common 3' exons as expected. These neural cadherin-like cell adhesion proteins are integral plasma membrane proteins. Their specific functions are unknown but they most likely play a critical role in the establishment and function of specific cell-cell neural connections.
Supplier:
Anaspec Inc
Description:
GIP (Glucose-dependent Insulinotropic Polypeptide or also known as Gastric Inhibitory Polypeptide) is a 42-amino acid peptide released by the K cells of the duodenum and jejunum in response to food intake. GIP, together with GLP (Gastric-like Peptide) are members of the hormone peptide family of Incretins which stimulate insulin secretion from pancreatic islet β-cells, and also appears to promote beta cell proliferation and beta cell survival. Recent studies suggest that GIP plays a role in lipid homeostasis and possibly in the pathogenesis of obesity.
Sequence: YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ MW: 4983.6 Da % Peak area by HPLC: 95 Storage condition: -20° C
Catalog Number:
(10751-646)
Supplier:
Prosci
Description:
SDHAF1 Antibody: SDHAF1 (Succinate dehydrogenase complex assembly factor 1) is one of the subunits of the succinate dehydrogenase (SDH) complex (or complex II) of the mitochondrial respiratory chain. SDHAF1 resides in the mitochondria, and is essential for SDH assembly, but does not physically associate with the complex in vivo. Mutations in this gene are associated with SDH-defective infantile leukoencephalopathy (mitochondrial complex II deficiency). Unlike the related protein SDHAF2, SDHAF1 is not thought to be a tumor suppressor.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
![]()
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
![]()
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
|
|||||||||