Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

2,5-Dibromo-1,3-diethylbenzene


150,241  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"150241"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  AMBEED, INC
Description:   trans-1,2-Diaminocyclohexane-N,N,N',N'-tetraacetic acid (CDTA) 98%
New Product
Catalog Number: (103530-916)

Supplier:  Acros Organics
Description:   1,3-Propane sultone, Purity: 97%, CAS Number: 1120-71-4, Molecular Formula: C3H6O3S, Molecular weight: 122.14, Synonyms: 1,2-Oxathiolane 2,2-dioxide, 3-Hydroxy-1-propanesulfonic acid gamma-sultone, Appearance: White to light yellow, Low melting solid or liquid, Size: 25G
Supplier:  Bachem Americas
Description:   Sequence: Fmoc-His(1-Me)-OH

Supplier:  Spectrum Chemicals
Description:   Edetic Acid, NF is used as a chelating agent in therapy and as preservative adjuncts. 
Small Business Enterprise
Supplier:  TCI America
Description:   CAS Number: 402-65-3
MDL Number: MFCD02181194
Molecular Formula: C6H4FNO2
Molecular Weight: 141.10
Purity/Analysis Method: >97.0% (GC,T)
Form: Crystal
Melting point (°C): 191
MSDS SDS
Supplier:  Thermo Scientific Chemicals
Description:   Powder, 22 mesh. Purity based on metal contaminates only.
MSDS SDS
Supplier:  Bachem Americas
Description:   Sequence: H-Trp-OH
Supplier:  BeanTown Chemical
Description:   CAS: 84348-37-8; MDL No: MFCD01860669 Solid; Molecular Formula: C10H15NO5; MW: 229.24 Melting Point: 160° (decomposes) Optical Rotation: [α]22/D +19.0 to +23.0°, c = 0.5 in acetone
MSDS SDS
Supplier:  Rockland Immunochemical
Description:   Anti-Catalase has been assayed against 1.0 µg of Catalase (Bovine Liver) in a standard capture ELISA using ABTS (2,2’-azino-bis-[3-ethylbenthiazoline-6-sulfonic acid])
Supplier:  Shenandoah Biotechnology
Description:   Interleukin 22 (IL-22), also called IL-TIF, is an IL-10 family member that is produced by activated dendritic cells and T lymphocytes. IL-22 signals via a heteroduplex receptor consisting of IL-22R and IL-10RB chains. IL-22 is a potent mediator of cellular inflammatory responses and wound healing.  
Supplier:  AMBEED, INC
Description:   5,5'-Dithiobis(2-nitrobenzoic acid) (Ellmans reagent, DTNB) 98%
Catalog Number: (77004-566)

Supplier:  AMBEED, INC
Description:   2,2',2'',2'''-(((3',6'-Dihydroxy-3-oxo-3H-spiro[isobenzofuran-1,9'-xanthene]-2',7'-diyl)bis(methylene))bis(azanetriyl))tetraacetic acid, Purity: AR, CAS: 1461-15-0, Appearance: Yellow to orange to red-brown powder or crytals, Storage: Keep in dark place, Sealed in dry, Room Temperature, Size: 1MG
Catalog Number: (103007-214)

Supplier:  Anaspec Inc
Description:   This is amino acids 1 to 40 fragment of the beta-amyloid peptide with lysine substituted for glutamic acid at position 22, found in Italian families. The Italian mutation of beta-amyloid 1-40 (E22K) aggregates more rapidly and with more potent neurotoxicity than wild-type beta-amyloid 1-40. The formation of a salt bridge between Lys-22 and Asp-23 in the minor conformer might be a reason why E22K-beta-amyloid 40 is more pathogenic than wild-type beta-amyloid 40.
Sequence: DAEFRHDSGYEVHHQKLVFFAKDVGSNKGAIIGLMVGGVV
Molecular Weight: 4328.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Supplier:  Rockland Immunochemical
Description:   Anti-Aldolase has been assayed against 1.0 µg of Aldolase (Rabbit Muscle) in a standard capture ELISA using ABTS (2,2’-azino-bis-[3-ethylbenthiazoline-6-sulfonic acid])
Supplier:  TCI America
Description:   4-(Aminomethyl)-1-tert-butoxycarbonylpiperidine, Purity: >98.0%(GC)(T), Cas number: 144222-22-0, Molecular Formula: C11H22N2O2, Molecular Weight: 214.31, Appearance: Clear liquid, Synonyms: 4-(Aminomethyl)-1-Boc-piperidine, Size: 1G
MSDS SDS
Supplier:  Bioss
Description:   C22orf37 (chromosome 22 open reading frame 37), also known as FLJ40542, is a 170 amino acid protein encoded by a gene located on human chromosome 22, which contains over 500 genes and about 49 million bases. As the second smallest human chromosome, chomosome 22 contains a wide variety of genes with numerous functions. Phelan-McDermid syndrome, Neurofibromatosis type 2 and autism are associated with chromosome 22. A schizophrenia susceptibility locus has been identified on chromosome 22 and studies show that 22q11 deletion symptoms include a high incidence of schizophrenia. Translocations between chromosomes 9 and 22 may lead to the formation of the Philadelphia Chromosome and the subsequent production of the novel fusion protein, BCR-Abl, a potent cell proliferation activator found in several types of leukemia.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
1 - 16  of 150,241