Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results

You Searched For:

1-(3-Chloro-4-fluorophenyl)ethanol


19,951  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"19951"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Catalog Number: (10112-686)

Supplier:  Prosci
Description:   Polyclonal, Host: Goat, Species: Human, Immunogen: FOXP4 antibody was raised against a 14 amino acid synthetic peptide near the N-Terminus of FOXP4, Application: ELISA, WB
Catalog Number: (77561-092)

Supplier:  Sino Biological
Description:   The 39 amino acids of PDKtide peptide sequence ([protein fragment, 39 aa]) is derived from two human proteins: residues 1-14 are based on AKT1 (307-320) and residues 16-39 are based on PKN2/PRK2 (961-984).
New Product
Catalog Number: (10113-968)

Supplier:  Prosci
Description:   Polyclonal, Host: Goat, Species Reactivity: Human, Immunogen: RCBTB2 antibody was raised against a 14 amino acid synthetic peptide near the internal region of RCBTB2, Tested Applications: ELISA
Catalog Number: (10115-110)

Supplier:  Prosci
Description:   Polyclonal, Host: Goat; Target Species: Human; Immunogen: Nprl3 Antibody was raised against a 14 amino acid sequence near the internal region (N-Terminus) of Nprl3 (mouse); Applications: ELISA,Western blotting
Catalog Number: (10112-856)

Supplier:  Prosci
Description:   Polyclonal, Host: Goat, Species: Human, Immunogen: PDE11A antibody was raised against a 14 amino acid synthetic peptide near the internal region of PDE11A, Application: ELISA, WB
Catalog Number: (10113-364)

Supplier:  Prosci
Description:   Polyclonal, Host: Goat, Species Reactivity: Human, Immunogen: GPR83 Antibody was raised against a 14 amino acid sequence near the N-Terminus of GPR83 , Tested Applications: ELISA, WB
Supplier:  Honeywell Research Chemicals
Description:   Adipic acid, Purity: 99.6-101.0%, Grade: puriss, CAS Number: 124-04-9, Molecular formula: HOOC(CH2)4COOH, Molar mass: 146.14 g/mol, Quality: meets analytical specification of Ph.Eur, BP, E 355, Size: 25KG
MSDS SDS
Supplier:  Thermo Scientific Chemicals
Description:   MDL: MFCD00002789 Beilstein Registry No.: 1754069 Soluble in water (increasing with temperature). Soluble in alcohol, methanol
MSDS SDS
Catalog Number: (10114-356)

Supplier:  Prosci
Description:   Polyclonal, Host: Goat; Target Species: Mouse, Rat; Immunogen: Tnfrsf1b antibody was raised against a 14 amino acid synthetic peptide near the internal region of Tnfrsf1b (mouse); Applications: ELISA,Western blotting
Catalog Number: (10113-904)

Supplier:  Prosci
Description:   Polyclonal, Host: Goat, Species Reactivity: Human, Immunogen: STK39 antibody was raised against a 14 amino acid synthetic peptide near the internal region of STK39, Tested Applications: ELISA, WB
Catalog Number: (10112-132)

Supplier:  Prosci
Description:   Polyclonal, Host: Goat, Species: Human, Mouse, Immunogen: UNC13D antibody was raised against a 14 amino acid synthetic peptide near the internal region of UNC13D, Application: ELISA, WB, IHC
Catalog Number: (10112-354)

Supplier:  Prosci
Description:   Polyclonal, Host: Goat, Species: Human, Mouse, Rat, Immunogen: AGTR1 antibody was raised against a 14 amino acid synthetic peptide near the internal region of AGTR1, Application: ELISA, WB
Supplier:  AOB CHEM USA
Description:   4-(Methanesulfonamido)phenylboronic acid pinacol ester ≥95%
Catalog Number: (10115-236)

Supplier:  Prosci
Description:   Polyclonal, Host: Goat; Target Species: Human; Immunogen: PRMT7 antibody was raised against a 14 amino acid peptide near the internal region of PRMT7; Applications: ELISA,Western blotting
Catalog Number: (10117-138)

Supplier:  Prosci
Description:   Polyclonal; Host: Goat; Species Reactiviy: Human; Immunogen: ApoL5 antibody was raised against a 14 amino acid synthetic peptide near the C-Terminus of ApoL5; Application: ELISA, Western Blot
Catalog Number: (10112-466)

Supplier:  Prosci
Description:   Polyclonal, Host: Goat, Species: Human, Immunogen: Arylsulfatase B antibody was raised against a 14 amino acid synthetic peptide near the internal region of Arylsulfatase B, Application: ELISA, WB, IHC
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
6,225 - 6,240  of 19,951