Text Search >
4-Azidobenzoic+acid
Print…
You Searched For:
32,218 results were found
4-Azidobenzoic+acid
Supplier:
Teknova
Description:
DNase, RNase and Protease tested Teknova Cell Culture Grade Water.
Supplier:
BeanTown Chemical
Description:
CAS: 7446-07-3; EC No: 231-193-1; MDL No: MFCD00011263; RTECS: WY2675000
Powder; Linear Formula: TeO2; MW: 159.60
Melting Point: 733°
Density (g/mL): 5.67
Supplier:
HiMedia
Description:
TMAO (Trimethylamine-N-Oxide Medium) medium is used for the cultivation and differentiation of Campylobacter species from foods, except <i>C. jejuni </i>and <i>C. coli</i> in accordance with APHA.
Catalog Number:
(103007-366)
Supplier:
Anaspec Inc
Description:
This is a modified beta-amyloid (1-42) peptide wherein at position 35, the methionine is in an oxidized state. The Methionine residue at position 35 has been shown to be responsible for the oxidative stress and neurotoxic properties both in vitro and in vivo. In addition, Aβ- bearing oxidized Met-35 is found in considerable amounts in post-mortem AD plaques and the accumulation of oxidized Met-35 seems to be related to reduced enzymatic reversal of methionine sulfoxide back to methionine observed in AD brains.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL-M(O)-VGGVVIA Molecular Weight: 4530.1 Da % Peak Area by HPLC: ≥95 Peptide Content: ≥ 60% Storage condition: -20°C
Supplier:
Thermo Scientific Chemicals
Description:
Cytotoxic compound that causes oxidative base damage to nuclear DNA
Catalog Number:
(10435-140)
Supplier:
Bioss
Description:
Aldehydic products of lipid peroxidation, such as 4 hydroxynonenal (4 HNE), have been implicated in the etiology of pathological changes under oxidative stress as a key mediator of oxidative stress induced cell death. It is a stable product of lipid peroxidation, is proarrhythmic and may contribute to the cytotoxic effects of oxidative stress
4-HNE has been hypothesized to play a key role in cell signal transduction, in a variety of pathways from cell cycle events to cellular adhesion.
Catalog Number:
(TCT0473-10ML)
Supplier:
TCI America
Description:
CAS Number: 503-30-0
MDL Number: MFCD00005167 Molecular Formula: C3H6O Molecular Weight: 58.08 Purity/Analysis Method: >98.0% (GC) Form: Clear Liquid Color: Colorless Boiling point (°C): 50 Flash Point (°C): -28 Specific Gravity (20/20): 0.90 Storage Temperature: 0-10°C
Supplier:
AMBEED, INC
Description:
Diphenyl ether 99%
Catalog Number:
(10435-136)
Supplier:
Bioss
Description:
Aldehydic products of lipid peroxidation, such as 4 hydroxynonenal (4 HNE), have been implicated in the etiology of pathological changes under oxidative stress as a key mediator of oxidative stress induced cell death. It is a stable product of lipid peroxidation, is proarrhythmic and may contribute to the cytotoxic effects of oxidative stress
4-HNE has been hypothesized to play a key role in cell signal transduction, in a variety of pathways from cell cycle events to cellular adhesion.
Catalog Number:
(80055-316)
Supplier:
MilliporeSigma
Description:
Stimulates the activity of inducible nitric oxide synthase
Catalog Number:
(89359-612)
Supplier:
Genetex
Description:
Heme oxygenase (HO) is a microsomal enzyme that catalyzes the oxidation of heme to the antioxidant molecules, biliverdin and carbon monoxide. HO consists of two homologous isozymes, an inducible HO1 and a constitutively expressed HO2. HO1 is induced by a wide variety of stimuli including conditions of oxidative stress, inflammatory agents, transforming growth factor beta and heat shock. The increase in expression of HO1 is thought to be a cellular defense mechanism against oxidative stress since elevated HO could eventually generate more bilirubin, an anti-oxidant.
Supplier:
Promega Corporation
Description:
The NAD/NADH-Glo Assay is a bioluminescent, homogeneous single-reagent-addition assay for detecting total oxidized and reduced nicotinamide adenine dinucleotides and determining their ratio in biological samples or in defined enzyme reactions.
Supplier:
BeanTown Chemical
Description:
CAS: 20816-12-0; EC No: 244-058-7; MDL No: MFCD00011150
UN No: UN3287; Haz Class: 6.1; Packing Group: III
Liquid; Linear Formula: OsO4; MW: 254.20
Melting Point: 0°; Boiling Point: 100°
Density (g/mL): 1.04
Catalog Number:
(10288-258)
Supplier:
Bioss
Description:
Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally unrelated compounds, including steroids, fatty acids, retinoid and xenobiotics. Preferentially oxidizes 17beta-estradiol to the carcinogenic 4-hydroxy derivative, and a variety of procarcinogenic compounds to their activated forms, including polycyclic aromatic hydrocarbons. Promotes angiogenesis by removing cellular oxygenation products, thereby decreasing oxidative stress, release of antiangiogenic factor THBS2, then allowing endothelial cells migration, cell adhesion and capillary morphogenesis. These changes are concommitant with the endothelial nitric oxide synthase activity and nitric oxide synthesis. Plays an important role in the regulation of perivascular cell proliferation, migration, and survival through modulation of the intracellular oxidative state and NF-kappa-B expression and/or activity, during angiogenesis. Contributes to oxidative homeostasis and ultrastructural organization and function of trabecular meshwork tissue through modulation of POSTN expression.
Catalog Number:
(10285-076)
Supplier:
Bioss
Description:
Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally unrelated compounds, including steroids, fatty acids, retinoid and xenobiotics. Preferentially oxidizes 17beta-estradiol to the carcinogenic 4-hydroxy derivative, and a variety of procarcinogenic compounds to their activated forms, including polycyclic aromatic hydrocarbons. Promotes angiogenesis by removing cellular oxygenation products, thereby decreasing oxidative stress, release of antiangiogenic factor THBS2, then allowing endothelial cells migration, cell adhesion and capillary morphogenesis. These changes are concommitant with the endothelial nitric oxide synthase activity and nitric oxide synthesis. Plays an important role in the regulation of perivascular cell proliferation, migration, and survival through modulation of the intracellular oxidative state and NF-kappa-B expression and/or activity, during angiogenesis. Contributes to oxidative homeostasis and ultrastructural organization and function of trabecular meshwork tissue through modulation of POSTN expression.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
 is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
|
|||||||||
List View
