Text Search >
5,5\\\'-Diallyl-2,2\\\'-dihydroxybiphenyl+(Magnolol)
Print…
You Searched For:
63,137 results were found
5,5\\\'-Diallyl-2,2\\\'-dihydroxybiphenyl+(Magnolol)
Supplier:
Ace Glass
Description:
Round-bottom flasks with three [ST] outer joints and #7 Ace-Thred neck
Catalog Number:
(IC15581380)
Supplier:
MP Biomedicals
Description:
A flavanone glycoside with neuroprotective and antioxidant properties. Does not inhibit oral carcinogenesis in a rat model unlike other citrus flavanones, but does exert a protective effect against gastritis and gastric lesions.
Catalog Number:
(76108-536)
Supplier:
Bioss
Description:
Cell cycle progression is subject to arrest at G1 and G2 checkpoints in response to DNA damage, presumably to allow time for DNA repair prior to entry into S and M phase, respectively. The p53 tumor suppressor is required for one such G1 checkpoint and functions to upregulate expression of GADD 45 and the mitotic inhibitory protein p21. GADD 45 stimulates DNA excision repair <i>in vitro</i> and inhibits entry of cells into S phase, and it apparently acts in concert with GADD 153 in inducing growth arrest. A related DNA-damage inducible gene, GADD 34 synergizes with GADD 45 or GADD 153 in suppressing cell growth. PEG-3 (progression elevated gene-3) shares significant homology with GADD 34 and is inducible by DNA damage. An additional GADD related gene, PA26, is a possible target of p53. Three isoforms of PA26 have been identified as PA26-T1, PA26-T2 and PA26-T3.
Catalog Number:
(10404-702)
Supplier:
Bioss
Description:
Protein tyrosine-protein phosphatase required for T-cell activation through the antigen receptor. Acts as a positive regulator of T-cell coactivation upon binding to DPP4. The first PTPase domain has enzymatic activity, while the second one seems to affect the substrate specificity of the first one. Upon T-cell activation, recruits and dephosphorylates SKAP1 and FYN (By similarity). Dephosphorylates LYN, and thereby modulates LYN activity (By similarity).
Supplier:
Adipogen
Description:
Hepatoprotective antioxidant. Anti-inflammatory. Suppresses NF-kB p65 activity. Neuroprotective. Apoptosis inhibitor. Bone resorption/osteoclastogenesis inhibitor. Reduces ROS formation. Antiseptic. AMP-activated kinase (AMPK) activator. Akt phosphorylation inhibitor.
Supplier:
Biotium
Description:
This antibody reacts with human CD48, a 45 kDa glycosyl phophatidyl-inositol (GPI)-anchored cell surface protein. CD48 is strongly expressed on lymphocytes and monocytes and weakly on granulocytes but is absent on platelets, fibroblasts, epithelium and endothelium. CD48 is one of marker for detecting the defects of GPI anchoring structure on the patients with paroxysmal nocturnal hemoglobulinuria (PNH) and serves as a low affinity ligand for CD2.
Supplier:
Thermo Scientific Chemicals
Description:
Artificial sweetener derived from citrus
Catalog Number:
(10404-704)
Supplier:
Bioss
Description:
Protein tyrosine-protein phosphatase required for T-cell activation through the antigen receptor. Acts as a positive regulator of T-cell coactivation upon binding to DPP4. The first PTPase domain has enzymatic activity, while the second one seems to affect the substrate specificity of the first one. Upon T-cell activation, recruits and dephosphorylates SKAP1 and FYN (By similarity). Dephosphorylates LYN, and thereby modulates LYN activity (By similarity).
Supplier:
AOB CHEM USA
Description:
2-(4-Fluorophenyl)tricyclo[3.3.1.13,7]Decan-2-ol ≥97%
Catalog Number:
(10404-706)
Supplier:
Bioss
Description:
Protein tyrosine-protein phosphatase required for T-cell activation through the antigen receptor. Acts as a positive regulator of T-cell coactivation upon binding to DPP4. The first PTPase domain has enzymatic activity, while the second one seems to affect the substrate specificity of the first one. Upon T-cell activation, recruits and dephosphorylates SKAP1 and FYN (By similarity). Dephosphorylates LYN, and thereby modulates LYN activity (By similarity).
Catalog Number:
(470231-448)
Supplier:
Wards
Description:
A versatile clamp to securely grip a variety of cylindrically shaped glass and labware.
Catalog Number:
(76118-234)
Supplier:
Bioss
Description:
This gene encodes one member of a family of translation repressor proteins. The protein directly interacts with eukaryotic translation initiation factor 4E (eIF4E), which is a limiting component of the multisubunit complex that recruits 40S ribosomal subunits to the 5' end of mRNAs. Interaction of this protein with eIF4E inhibits complex assembly and represses translation. This protein is phosphorylated in response to various signals including UV irradiation and insulin signaling, resulting in its dissociation from eIF4E and activation of mRNA translation.
Catalog Number:
(103006-368)
Supplier:
Anaspec Inc
Description:
BNP-45 represents the 45 amino acids at the C-terminus and the mouse BNP-45 has all the amino acid residues thought essential for NP bioactivity, although sequence identity when studied with other BNP hormones (rat, 64%; dog, 53%; pig, 50%; and human, 44%) was clearly less than the identity among ANF hormones. The threonine 81 residue at which a protein kinase C phosphorylation site is present in the putative mature mouse BNP-45 hormone is not conserved in the rat sequence.
Sequence:SQDSAFRIQERLRNSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (Disulfide bridge:23 - 39) MW:5040.8 Da %Peak area by HPLC:≥95% Storage condition: -20°C
Catalog Number:
(10800-292)
Supplier:
Rockland Immunochemical
Description:
Beta2-microglobulin (B2M) is a principal component of the Major Histocompatibility Complex (MHC) class I molecule, a ternary membrane protein complex that displays fragments derived from proteolyzed cytosolic proteins on the surface of cells for recognition by the surveillance immune system (1,2). B2M is involved in the presentation of peptide antigens to the immune system and plays a critically important role in immune system function (3). It is expressed on nearly all nucleated cells and contains one Ig-like C1-type (immunoglobulin-like) domain (2,3). Mutations in the Beta 2-microglobulin gene can enhance the progression of malignant melanoma and osteoarthropathy (4,5).
Catalog Number:
(10278-912)
Supplier:
Bioss
Description:
HEM1 is a 1,127 amino acid single-pass membrane protein that localizes to the cytoplasmic side of the cell membrane. One of several members of the highly conserved HEM family of tissue-specific transmembrane proteins, HEM1 is expressed in cells of hematopoietic origin where it is thought to play an important role in oogenesis. The gene encoding HEM1 maps to human chromosome 12, which encodes over 1,100 genes and comprises approximately 4.5% of the human genome. Chromosome 12 is associated with a variety of diseases and afflictions, including hypochondrogenesis, achondrogenesis, Kniest dysplasia, Noonan syndrome and Trisomy 12p, which causes facial developmental defects and seizure disorders.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
 is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
|
|||||||||
List View
