Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results

You Searched For:

4-Propoxy[1,1'-biphenyl]-3-carbaldehyde


44,834  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"44834"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Catalog Number: (10752-228)

Supplier:  Prosci
Description:   Thioredoxin-interacting protein (TXNIP) belongs to the arrestin family and plays a critical role in the antioxidant defense mechanisms of hematopoietic cells by activating the p53 pathway during oxidative stress. It functions as a transcriptional repressor and acts as an oxidative stress mediator by inhibiting thioredoxin activity. TXNIP expression is reduced in many types of tumors, and TXNIP overexpression inhibits tumor growth by blocking cell-cycle progression. It has recently reported that TXNIP deficiency correlates with a high incidence of hepatocellular carcinoma (HCC). TXNIP and p53 interactions could potentially be a therapeutic target for oxidative stress-related diseases such as hematopoietic malignancies and metabolic diseases.

Supplier:  AFG BIOSCIENCE LLC
Description:   Mouse neuronal Nitric Oxide Synthase(nNOS) ELISA Kit

Supplier:  AFG BIOSCIENCE LLC
Description:   Human Neuronal Nitric Oxide Synthase (nNOS) ELISA Kit
Supplier:  AFG BIOSCIENCE LLC
Description:   Rat Endothelial Nitric Oxide Synthase 3 (eNOS-3) ELISA Kit
Supplier:  THERMO FISHER SCIENTIFIC CHEMICALS
Description:   Trimethyl phosphate 99%
Supplier:  MP Biomedicals
Description:   Polyethylene glycol (PEG) is a condensation polymer of ethylene oxide and water. PEGs are susceptible to oxidative degradation in the presence of air. Minimizing the exposure of PEG to elevated temperatures and/or exposure to oxygen, or addition of an antioxidant can limit the amount of degradation. PEGs do not hydrolyze or deteriorate upon storage. PEGs do not support the growth of molds. PEG is incompatible with phenol and may reduce the antimicrobial action of other preservatives.

Supplier:  AFG BIOSCIENCE LLC
Description:   Human TMAO (Trimethylamine-N-oxide) ELISA Kit
Supplier:  Thermo Scientific Chemicals
Description:   MDL: MFCD00149765
MSDS SDS
Supplier:  GE Healthcare - HyClone
Description:   Water for Injection (WFI) quality water supports cell culture growth and biomanufacturing processes.
MSDS SDS
Supplier:  Honeywell Research Chemicals
Description:   Silicon dioxide, Grade: Analytical, Cas number: 14808-60-7, Molecular Formula: SiO2, Molar mass: 60.08 g/mol, Synonym: Sand, white quartz, Quartz, Silicon dioxide, Adsorbent Drying Agent, Application: For cleaning of platinum crucibles, calcined, crude, Size: 2.5KG
MSDS SDS
Supplier:  Thermo Scientific Chemicals
Description:   Lithium nitrate, anhydrous is used in the manufacture of red-colored fireworks and flares. has been proposed as a medium to store heat collected from the sun for cooking. A Fresnel lens would be used to melt solid lithium nitrate, which would then function as a solar battery, allowing heat to be redistributed later by convection
MSDS SDS
Supplier:  BeanTown Chemical
Description:   CAS: 7446-07-3; EC No: 231-193-1; MDL No: MFCD00011263; RTECS: WY2675000 Powder; Linear Formula: TeO2; MW: 159.60 Melting Point: 733° Density (g/mL): 5.67
MSDS SDS
Supplier:  Teknova
Description:   DNase, RNase and Protease tested Teknova Cell Culture Grade Water.
Catalog Number: (103007-366)

Supplier:  Anaspec Inc
Description:   This is a modified beta-amyloid (1-42) peptide wherein at position 35, the methionine is in an oxidized state. The Methionine residue at position 35 has been shown to be responsible for the oxidative stress and neurotoxic properties both in vitro and in vivo. In addition, Aβ- bearing oxidized Met-35 is found in considerable amounts in post-mortem AD plaques and the accumulation of oxidized Met-35 seems to be related to reduced enzymatic reversal of methionine sulfoxide back to methionine observed in AD brains.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL-M(O)-VGGVVIA
Molecular Weight: 4530.1 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier:  Bioss
Description:   Aldehydic products of lipid peroxidation, such as 4 hydroxynonenal (4 HNE), have been implicated in the etiology of pathological changes under oxidative stress as a key mediator of oxidative stress induced cell death. It is a stable product of lipid peroxidation, is proarrhythmic and may contribute to the cytotoxic effects of oxidative stress

4-HNE has been hypothesized to play a key role in cell signal transduction, in a variety of pathways from cell cycle events to cellular adhesion.
Catalog Number: (TCT0473-10ML)

Supplier:  TCI America
Description:   CAS Number: 503-30-0
MDL Number: MFCD00005167
Molecular Formula: C3H6O
Molecular Weight: 58.08
Purity/Analysis Method: >98.0% (GC)
Form: Clear Liquid
Color: Colorless
Boiling point (°C): 50
Flash Point (°C): -28
Specific Gravity (20/20): 0.90
Storage Temperature: 0-10°C
MSDS SDS
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
6,321 - 6,336  of 44,834
  1  2  3  4  5  6  7  8  9  10  11  12  13  14  15  Next