Ethyl+5-bromo-\\\\u03B1-oxobenzo[b]thiophene-2-acetate
Catalog Number:
(RL200-6335S)
Supplier:
Rockland Immunochemical
Description:
Anti-Alkaline phosphatase has been assayed against 1.0 µg of Alkaline Phosphatase (Calf Intestine) in a standard capture ELISA using ABTS (2,2’-azino-bis-[3-ethylbenthiazoline-6-sulfonic acid])
Catalog Number:
(RL200-1378S)
Supplier:
Rockland Immunochemical
Description:
Anti-Pyruvate Kinase has been assayed against 1.0 µg of Pyruvate Kinase (Rabbit Muscle) in a standard capture ELISA using ABTS (2,2’-azino-bis-[3-ethylbenthiazoline-6-sulfonic acid])
Catalog Number:
(103231-418)
Supplier:
Novus Biologicals
Description:
BASP1, Polyclonal Antibody, Host: Sheep, Species reactivity: Human, Isotype: IgG, Immunogen: E. Coli-derived recombinant human BASP1, Synonyms: CAP23, CAP-23, CAP23brain acid soluble protein 1, NAP-22, Concentration: LYOPH, Application: Western Blot, Size: 25ug
Supplier:
TCI America
Description:
CAS Number: 10349-57-2
MDL Number: MFCD00047613 Molecular Formula: C10H7NO2 Molecular Weight: 173.17 Purity/Analysis Method: >98.0% (HPLC,T) Form: Crystal Color: Very Pale Yellow Melting point (°C): 291
Catalog Number:
(76110-320)
Supplier:
Bioss
Description:
The RING-type zinc finger motif is present in a number of viral and eukaryotic proteins and is made of a conserved cysteine-rich domain that is able to bind two zinc atoms. Proteins that contain this conserved domain are generally involved in the ubiquitination pathway of protein degradation. RNF215 (ring finger protein 215), is a 377 amino acid multi-pass membrane protein containing one RING-type zinc finger. The gene encoding RNF215 maps to human chromosome 22, which houses over 500 genes and is the second smallest human chromosome. Mutations in several of the genes that map to chromosome 22 are involved in the development of Phelan-McDermid syndrome, Neurofibromatosis type 2, autism and schizophrenia.
Catalog Number:
(10072-538)
Supplier:
Prosci
Description:
VCAM is a 110 kDa cell surface integral membrane glycoprotein that belongs to the Ig-related superfamily of adhesion molecules. The primary function of VCAM-1 is the mediation of leukocyte-endothelial cell adhesion and signal transduction. VCAM-1 may play a vital role in the development several diseases, including atherosclerosis and rheumatoid arthritis. The human VCAM-1 gene codes for a 715 amino acid transmembrane glycoprotein containing a 19 amino acid cytoplasmic domain, a 22 amino acid transmembrane domain, and a 674 amino acid extracellular domain. Recombinant human VCAM-1 is a kDa glycoprotein comprising the extracellular domain (674 amino acid residues) of VCAM-1. Monomeric glycosylated VCAM-1 migrates at an apparent molecular weight of approximately 74.1kDa by SDS-PAGE analysis under reducing conditions.
Supplier:
Matrix Scientific
Description:
Matrix Scientific Part Number: 058738-500MG , MDL Number: MFCD10568176
Supplier:
Adipogen
Description:
Activated ester of ruthenium complex for acylation of amino acid side chain amines. This label is perfectly suitable for 1D- or 2D-protein gel staining. A simple pre-electrophoresis procedure provides a sensitivity better than SYPRO Ruby and a similar dynamic range. In contrast to SYPRO Ruby, this staining exhibits a logarithmic dependency on the amount of protein.
Catalog Number:
(EM1.08445.0250)
Catalog Number:
(103007-216)
Supplier:
Anaspec Inc
Description:
This is amino acids 1 to 42 fragment of the beta-amyloid peptide, with lysine substituted for glutamic acid at position 22 found in Italian families with Alzheimer's disease. The Italian mutation of beta -amyloid 1 to 42 (E22K) aggregates more rapidly and with more potent neurotoxicity than wild-type beta-amyloid (1-42). The formation of a salt bridge between Lys22 and Asp23 in the minor conformer might be a reason why E22K is more pathogenic than wild-type beta-amyloid (1-42).
Sequence: DAEFRHDSGYEVHHQKLVFFAKDVGSNKGAIIGLMVGGVVIA MW: 4513.1 Da % Peak Area by HPLC: ≥95 Peptide Content: ≥ 60% Storage condition: -20°C
Supplier:
Bon Opus Biosciences
Description:
Bon Opus Biosciences offers quality recombinant proteins products covering a broad collection of cytokines, enzymes, diagnostic and detection reagents, and other protein-related products
Supplier:
THERMO FISHER SCIENTIFIC CHEMICALS
Description:
Calcein
Catalog Number:
(RL609-703-002)
Supplier:
Rockland Immunochemical
Description:
This product has been assayed against 1.0 µg of Human IgG in a standard capture ELISA using ABTS (2,2’-azino-bis-[3-ethylbenthiazoline-6-sulfonic acid])
Catalog Number:
(RL612-703-002)
Supplier:
Rockland Immunochemical
Description:
This product has been assayed against 1.0 µg of Rat IgG in a standard capture ELISA using ABTS (2,2’-azino-bis-[3-ethylbenthiazoline-6-sulfonic acid])
Catalog Number:
(10670-278)
Supplier:
Bioss
Description:
The RING-type zinc finger motif is present in a number of viral and eukaryotic proteins and is made of a conserved cysteine-rich domain that is able to bind two zinc atoms. Proteins that contain this conserved domain are generally involved in the ubiquitination pathway of protein degradation. RNF215 (ring finger protein 215), is a 377 amino acid multi-pass membrane protein containing one RING-type zinc finger. The gene encoding RNF215 maps to human chromosome 22, which houses over 500 genes and is the second smallest human chromosome. Mutations in several of the genes that map to chromosome 22 are involved in the development of Phelan-McDermid syndrome, Neurofibromatosis type 2, autism and schizophrenia.
Catalog Number:
(RL200-103-189S)
Supplier:
Rockland Immunochemical
Description:
Anti-Invertase has been assayed against 1.0 µg of Invertase (Candida) in a standard capture ELISA using ABTS (2,2’-azino-bis-[3-ethylbenthiazoline-6-sulfonic acid])
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
![]()
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
![]()
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
|
|||||||||