Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

3-Amino-3-(4-bromophenyl)propionic+acid


158,755  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"158755"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  TCI America
Description:   CAS Number: 7765-11-9
MDL Number: MFCD00037263
Molecular Formula: C11H12ClNO3
Molecular Weight: 241.67
Purity/Analysis Method: >97.0% (T)
Form: Crystal
Melting point (°C): 127
MSDS SDS
Catalog Number: (77048-936)

Supplier:  ANTIBODIES.COM LLC
Description:   Rabbit polyclonal antibody to MMP-11 for WB, IHC, IF and ELISA with samples derived from Human, Mouse and Rat.
Supplier:  AMBEED, INC
Description:   2-Chloro-6-methylquinoline, Purity: 98%, CAS Number: 4295-11-8, Appearance: Pale-yellow to Yellow-brown Solid, Storage: Inert atmosphere, Room Temperature, Size: 25g
Supplier:  Novus Biologicals
Description:   Splicing factor, arginine/serine-rich 11 Overexpression Lysate (Adult Normal)
Catalog Number: (77573-510)

Supplier:  AMBEED, INC
Description:   Coumarin 102 ≥97%
New Product

Supplier:  AMBEED, INC
Description:   Methyl 1H-pyrrolo[3,2-b]pyridine-6-carboxylate, Purity: 97%, CAS number: 1015609-11-6, Appearance: Form: solid, Storage: Sealed in dry, Room Temperature, Size: 250MG
Supplier:  Spectrum Chemicals
Description:   Triisopropanolamine, also known as 1-Amino-2-propanol, is an amino alcohol and can be used in several applications to achieve buffering, basicity, and alkalinity objectives.
Small Business Enterprise
Supplier:  ANTIBODIES.COM LLC
Description:   Mouse monoclonal (821) antibody to Collectin 11 for WB, IF and ELISA with samples derived from Human, Mouse, Rat and Hamster.
Supplier:  AMBEED, INC
Description:   5'-(4-Formylphenyl)-[1,1':3',1''-terphenyl]-4,4''-dicarbaldehyde, Purity: 97%, CAS Number: 118688-53-2, Appearance: White to light yellow-red solid, Storage: Inert atmosphere, 2-8 C, Size: 1g
Supplier:  Matrix Scientific
Description:   (S)-(+)-3, 3'-Bis(3, 5-Bis(Trifluoromethyl)Phenyl)-1, 1'-Binaphthyl-2, 2'-Diyl Hydrogenphosphate, MF=C36H17F12O4P, MW=772.49, CAS=878111-17-2, 1G
MSDS SDS
Supplier:  VWR International
Description:   VWR® 8" diameter (203.2 mm ) all brass test sieves are durable and ideal for sieving applications where a medium sample size is required.
Small Business Enterprise
Supplier:  AMBEED, INC
Description:   (4S,4'S,5R,5'R)-2,2'-(Cyclohexane-1,1-diyl)bis(4,5-diphenyl-4,5-dihydrooxazole) ≥97%, ee 99%
New Product
Catalog Number: (103005-822)

Supplier:  Anaspec Inc
Description:   Post-mortem Alzheimer’s diseased brain specimens reveals significant levels of Aß (11-40/42) within insoluble amyloid pools. The ß-secretase enzyme or ß-amyloid precursor protein-cleaving enzyme (BACE) generates the N terminus of Aß, ultimately leading to the production of full-length Aß (1-40/42) or truncated Aß (11-40/42). The abundance of Aß (11-40/42) produced by BACE suggests that their roles in AD pathogenesis may be important.
Sequence: EVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Molecular Weight: 3151.7 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier:  Sino Biological
Description:   This antibody was produced from a hybridoma resulting from the fusion of a mouse myeloma with B cells obtained from a mouse immunized with purified, recombinant Human KLK11 / Kallikrein 11 (rh KLK11 / Kallikrein 11; Catalog#10767-H08H; NP_006844.1; Met1-Asn250). The IgG fraction of the cell culture supernatant was purified by Protein A affinity chromatography.
Supplier:  TCI America
Description:   CAS Number: 194019-11-9 MDL Number: MFCD04038373 Molecular Formula: C8H6BrFO2 Molecular Weight: 233.04 Purity/Analysis Method: <gt/>97.0% (GC,T) Form: Crystal Melting point (°C): 67
MSDS SDS
Catalog Number: (103223-668)

Supplier:  Novus Biologicals
Description:   LRP-11, Polyclonal Antibody, Host: Sheep, Species reactivity: Human, Isotype: IgG, Immunogen: E. Coli-derived recombinant human LRP-11 Ala38-Gly450 (Pro92Arg), synonyms: low density lipoprotein receptor-related protein 11, Application: WB, IHC, Size: 25UG
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
6,913 - 6,928  of 158,755