Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

3-(Propionyloxy)benzoic+acid


142,015  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"142015"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  Shenandoah Biotechnology
Description:   Interleukin 22 (IL-22), also called IL-TIF, is an IL-10 family member that is produced by activated dendritic cells and T lymphocytes. IL-22 signals via a heteroduplex receptor consisting of IL-22R and IL-10Rbeta chains. IL-22 is a potent mediator of cellular inflammatory responses. 
Catalog Number: (103003-156)

Supplier:  Anaspec Inc
Description:   AM (22-52) is known as an adrenomedullin receptor antagonist and a cardiac depressant factor, although there is some discrepancy in the literature regarding the selectivity of ADM 22-52 as adrenomedullin receptor antagonist.
Sequence:TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2
MW:3576 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Supplier:  AMBEED, INC
Description:   (3aS,3a'S,8aR,8a'R)-2,2'-(1,3-Bis(4-(tert-butyl)phenyl)propane-2,2-diyl)bis(3a,8a-dihydro-8H-indeno[1,2-d]oxazole)(97%), Purity: 98% 99%ee, CAS Number: 1435467-28-9, Appearance: White to Yellow Solid, Storage: Inert atmosphere, 2-8C, Size: 250MG
Catalog Number: (75794-402)

Supplier:  Prosci
Description:   Interleukin-22 (IL-22), also known as IL-10 related T cell derived inducible factor (ILTIF) was initially identified as a gene induced by IL-9 in mouse T cells and mast cells. IL-22 has been shown to activate STAT1 and STAT3 in several hepatoma cell lines and upregulate the production of acute phase proteins. IL-22 is produced by normal T cells upon anti-CD3 stimulation in humans. Mouse IL-22 expression is also induced in various organs upon lipopolysaccharide injection, suggesting that IL-22 may be involved in inflammatory responses. The functional IL-22 receptor complex consists of two receptor subunits, IL-22R(CRF29) and IL-10Rbeta(CRF24), belonging to the class II cytokine receptor family.
Supplier:  AMBEED, INC
Description:   Bis(2-hydroxyphenyl)methanone, Purity: 99%, CAS Number: 835-11-0, Appearance: Yellow to green to brown Powder or Crystal, Storage: Keep in dark place, Sealed in dry, Room Temperature, Size: 100g
Supplier:  AMBEED, INC
Description:   3-(6-(1-(2,2-Difluorobenzo[d][1,3]dioxol-5-yl)cyclopropanecarboxamido)-3-methylpyridin-2-yl)benzoic acid, Purity: 98%, CAS Number: 936727-05-8, Appearance: White to off-white powder or crystals, Storage: Keep in dark place, Inert atmosphere, Room temperature, Size: 1G
Catalog Number: (76303-794)

Supplier:  PeproTech, Inc.
Description:   IL-22 is a member of the IL-10 family of regulatory cytokines, which includes IL-10, IL-19, IL-20, IL-22, IL-24 and IL-26. Members of this family share partial homology in their amino acid sequences, but they are dissimilar in their biological functions. Produced by T lymphocytes, IL-22 inhibits IL-4 production by Th2 cells, and induces acute phase reactants in the liver and pancreas. IL-22 signals through a receptor system consisting of IL-10Rbeta/CRF2-4 and IL-22R, both of which are members of the class II cytokine-receptor family. Recombinant Human IL-22 is a 33.6 kDa, non-disulfide-linked, homodimeric protein consisting of two 147 amino acid polypeptide chains.
Supplier:  AMBEED, INC
Description:   (S)-(6,6'-Dimethoxybiphenyl-2,2'-diyl)bis[bis(3,4,5-trimethoxyphenyl)phosphine], Purity: 98%, CAS Number: 927396-01-8, Appearance: Form: powder Colour: light yellow, Storage: Inert atmosphere, Room Temperature, Size: 1g
Supplier:  AMBEED, INC
Description:   (S)-3,3'-Bis(4-nitrophenyl)-5,5',6,6',7,7',8,8'-octahydro-[1,1'-binaphthalene]-2,2'-diol, Purity: 97%, CAS Number: 2129645-35-6, Appearance: Solid, Storage: Inert atmosphere, 2-8C, Size: 100MG
Supplier:  TCI America
Description:   CAS Number: 32233-43-5
MDL Number: MFCD02682967
Molecular Formula: C7H14O3
Molecular Weight: 146.19
Purity/Analysis Method: >95.0% (GC)
Form: Clear Liquid
Boiling point (°C): 92
Flash Point (°C): 101
Specific Gravity (20/20): 1.03
Specific rotation [a]20/D: 2 deg (C=1, CHCl3)
MSDS SDS
Supplier:  TCI America
Description:   CAS Number: 10038-40-1
MDL Number: MFCD00191613
Molecular Formula: C14H14O3
Molecular Weight: 230.26
Purity/Analysis Method: >98.0% (GC)
Form: Crystal
Melting point (°C): 99
MSDS SDS
Supplier:  AMBEED, INC
Description:   (3aS,8aS)-4,4,8,8-Tetrakis(3,5-diethylphenyl)-2,2-dimethyl-6-phenyltetrahydro-[1,3]dioxolo[4,5-e][1,3,2]dioxaphosphepine, Purity: 97%, CAS Number: 2639939-72-1, Appearance: Solid, Storage: Inert atmosphere, 2-8C, Size: 250MG
Supplier:  GOODFELLOW CORPORATION
Description:   Gold ≥99.95%, disk, as roll, Diameter 22 mm
New Product
Supplier:  AMBEED, INC
Description:   (R)-3,3'-bis(10-phenyl-9-anthracenyl)-1,1'-binaphthyl-2,2'-diyl Hydrogenphosphate, Purity: 98%, CAS Number: 1262129-47-4, Appearance: Solid, Storage: Inert atmosphere, 2-8 C, Size: 25mg
Supplier:  AMBEED, INC
Description:   (R)-2,2'-Bis[bis(4-methoxy-3,5-di-t-butylphenyl)phosphino]-4,4',6,6'-tetramethoxy)-1,1'-biphenyl, Purity: 98%, CAS Number: 1365531-98-1, Appearance: Solid, Storage: Inert atmosphere, Room Temperature, Size: 100mg
Supplier:  AMBEED, INC
Description:   2,2-Dimethyl-2,3-dihydrobenzofuran-4-carboxylic acid, Purity: 97%, CAS Number: 123656-35-9, Appearance: Solid, Storage: Sealed in dry, 2-8 C, Size: 1g
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
2,577 - 2,592  of 142,015