Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

3,3-Dimethylpiperidin-4-one+hydrochloride


58,514  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"58514"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  AMBEED, INC
Description:   4-Hydroxy-3-methoxybenzaldehyde, Purity: 99%, CAS number: 121-33-5, Appearance: Form: Crystal - Powder, Storage: Keep in dark place, Inert atmosphere, Room temperature, Size: 100G
Supplier:  AMBEED, INC
Description:   3-Bromo-5-methylbenzene-1-sulfonyl chloride, Purity: 97%, CAS Number: 885520-33-2, Appearance: White to Yellow Solid, Storage: Inert atmosphere, Room Temperature, Size: 10g
Supplier:  AMBEED, INC
Description:   2-Bromo-4-chlorobenzaldehyde, Purity: 95%, CAS Number: 84459-33-6, Appearance: Form: Crystal - Powder / Colour: White - Yellow, Storage: Inert atmosphere, Room Temperature, Size: 100G
Catalog Number: (103003-038)

Supplier:  Anaspec Inc
Description:   Purified metalloendopeptidase cleaves the Gly33-Leu34 bond of Alzheimer Aß (1-40) peptide producing soluble 1-33 and 34-40 fragments of Aß (1-40) without any neurotoxic effects.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIG
Molecular Weight: 3674 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Supplier:  Thermo Scientific Chemicals
Description:   97% 25G
MSDS SDS
Supplier:  AMBEED, INC
Description:   6-Chloro-1H-pyrazolo[4,3-c]pyridine, Purity: 98%, CAS number: 1206979-33-0, Appearance: Form: solid, Storage: Keep in dark place, Sealed in dry, Room Temperature, Size: 100G

Supplier:  Genetex
Description:   PE-conjugated Mouse Monoclonal antibody [mAb#33] to CD158d
Supplier:  AMBEED, INC
Description:   2-Bromo-9,9-di-p-tolyl-9H-fluorene, Purity: 98%, CAS Number: 474918-33-7, Appearance: White to light yellow powder to crystal, Storage: Sealed in dry, Room Temperature, Size: 1G
Supplier:  Matrix Scientific
Description:   MF=C8H7Bro2 MW=215.05 Cas=76006-33-2 MDL=MFCD00270097 100G
MSDS SDS
Supplier:  TCI America
Description:   CAS Number: 1871-22-3
MDL Number: MFCD00040933
Molecular Formula: C40H32Cl2N8O2
Molecular Weight: 727.65
Purity/Analysis Method: >95.0% (T)
Form: Crystal
Melting point (°C): 248
MSDS SDS
Supplier:  AMBEED, INC
Description:   3,3-Bis(3-chloro-4-hydroxyphenyl)-3H-benzo[c][1,2]oxathiole 1,1-dioxide, Purity: Ind, CAS Number: 4430-20-0, Appearance: Solid, Storage: Inert atmosphere, Room Temperature, Size: 1G
Supplier:  BeanTown Chemical
Description:   CAS: 7440-33-7; EC No: 231-143-9; MDL No: MFCD00011461 Solid; Molecular Formula: W; MW: 183.84 Melting Point: 3410°; Boiling Point: 5660° Density (g/mL): 19.3
MSDS SDS
Supplier:  AVANTOR PERFORMANCE MATERIALS US
Description:   Calcium pantothenate 90.0-100.0% USP
Catalog Number: (77670-750)

Supplier:  AMBEED, INC
Description:   Motesanib ≥98%
New Product
Supplier:  AMBEED, INC
Description:   (R)-3-Amino-1,2,3,4-tetrahydrocarbazole 98%
Supplier:  Enzo Life Sciences
Description:   Produced in E. coli. Untagged mouse IL-33 (aa 109-266).
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
2,561 - 2,576  of 58,514