Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results

You Searched For:

4-Hexen-3-one


0  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"0"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  AMBEED, INC
Description:   2-Amino-9-((2R,3R,4S,5R)-3,4-dihydroxy-5-(hydroxymethyl)tetrahydrofuran-2-yl)-1-methyl-1H-purin-6(9H)-one ≥97%
New Product
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 037601-500MG , MDL Number: MFCD04032398
Supplier:  THERMO FISHER SCIENTIFIC CHEMICALS
Description:   Bis(cyclopentadienyl)zirconium dichloride 98+%
Supplier:  Matrix Scientific
Description:   3,5-Bis(trifluoromethyl)benzamidine hydrochloride ≥97%

Supplier:  Anaspec Inc
Description:   Glucagon-like peptide-2 (GLP-2) promotes nutrient absorption via expansion of the mucosal epithelium by stimulation of crypt cell proliferation and inhibition of apoptosis in the small intestine. It also reduces epithelial permeability, and decreases meal-stimulated gastric acid secretion and gastrointestinal motility. GLP-2 promotes the expansion of the intestinal epithelium through stimulation of the GLP-2 receptor, a member of the glucagon-secretin G protein-coupled receptor superfamily.
Sequence: HADGSFSDEMNTILDNLAARDFINWLIQTKITDR
MW: 3922.4 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Supplier:  AMBEED, INC
Description:   (2R,3R,4S,5S)-2-(6-Amino-9H-purin-9-yl)-5-((isobutylthio)methyl)tetrahydrofuran-3,4-diol, Purity: 98%, CAS Number: 35899-54-8, Appearance: Solid, Storage: Keep in dark place, Inert atmosphere, 2-8 C, Size: 50mg
Supplier:  Thermo Scientific Chemicals
Description:   3-Bromobenzenetrifluoroboric acid potassium salt 3-Bromophenyltrifluoroboric acid potassium salt. Grade: 97. Melting Point C178-182*. Boiling Point C: NA. C6H4BBrF3K. 374564-34-8. IRRITANT
MSDS SDS
Supplier:  Thermo Scientific Chemicals
Description:   500G
MSDS SDS
Catalog Number: (ABCA_AB74548-100UG)

Supplier:  ABCAM INC.
Description:   Anti-IL-34 Rabbit Polyclonal Antibody
New Product
Supplier:  TCI America
Description:   Cesium(I) bis(trifluoromethanesulfonyl)imide ≥98.0% (by titrimetric analysis)
Supplier:  THERMO FISHER SCIENTIFIC CHEMICALS
Description:   Bis(2-bromoethyl)ether 90%
Supplier:  AOB CHEM USA
Description:   2,5-Bis(trifluoromethyl)phenol ≥97% research grade
Supplier:  AMBEED, INC
Description:   (2R,3R,4R,5R,6R)-5-Acetamido-2-(acetoxymethyl)-6-((6-(((benzyloxy)carbonyl)amino)hexyl)oxy)tetrahydro-2H-pyran-3,4-diyl diacetate, Purity: 97%, CAS Number: 159173-77-0, Appearance: Solid, Storage: Inert atmosphere, Store in freezer, under -20 C, Size: 5g
Catalog Number: (103006-992)

Supplier:  Anaspec Inc
Description:   Beta-amyloid is the main component of amyloid deposits in the AD brain. Beta-amyloid peptides have a heterogeneous C-terminus with the majority composed ofAβ1-40, while a minor product is Aβ 1-42. Additional minor Aβ peptides are also normally produced, such as Beta-amyloid 1-34, 1-37, 1-38 and 1-39, and few reports have quantified the levels of these peptides in the brain.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL
Molecular Weight: 3787.2 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Supplier:  TCI America
Description:   4-(Biphenyl-4-yl)-6-(4-bromophenyl)-2-phenylpyrimidine, Purity: >98.0%(HPLC), Cas no. 1421599-34-9, Molecular formula: C28H19BrN2, Form: Crystal- Powder, Colour: White - Pale yellow, Size: 1G
MSDS SDS

Supplier:  Matrix Scientific
Description:   MF=C10H7F6No MW=271.16 Cas=16143-84-3 MDL=MFCD00089454 5G
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
401 - 0  of 0