Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

4-(Trifluoromethyl)cyclohexanol+(cis-+and+trans-+mixture)


139,837  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"139837"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  TCI America
Description:   CAS Number: 105-39-5
MDL Number: MFCD00000932
Molecular Formula: C4H7ClO2
Molecular Weight: 122.55
Purity/Analysis Method: >98.0% (GC)
Form: Clear Liquid
Boiling point (°C): 143
Melting point (°C): -26
Flash Point (°C): 57
Specific Gravity (20/20): 1.15
MSDS SDS
Catalog Number: (470345-528)

Supplier:  Wards
Description:   Designed for hydro distillation, this 9-piece kit includes a 250 ml flask and various components with 19/26 joints, offering convenience and reliability for extracting essential oils and other hydro-distilled substances in laboratory work.
Supplier:  Anaspec Inc
Description:   A number of Aß protein variants, differing only at their carboxy terminus (1-39, 1-40, 1-42 and 1-43), are identified as the major components of the cerebral amyloid deposits in Alzheimer’s disease. The length of the C-terminus is a critical determinant of the rate of amyloid formation (“kinetic solubility”), with only a minor effect on the thermodynamic solubility. Amyloid formation by the kinetically soluble peptides (e.g. 1-39) can be nucleated, or “seeded” by peptides which include the critical C-terminal residues (1-42, 26-42, 26-43, 34-42).
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGV
Molecular Weight: 4230.7 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 061764-500MG , MDL Number: MFCD03422867
Catalog Number: (101925-552)

Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 063327-500MG , MDL Number: MFCD15146421
Catalog Number: (101833-636)

Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 032395-1G , MDL Number: MFCD04972884
Catalog Number: (77667-662)

Supplier:  AMBEED, INC
Description:   Verofylline 98%
New Product
Supplier:  LGC STANDARDS
Description:   Disperse Blue 26 100 µg/mL in Acetonitrile:Methanol, Dr. Ehrenstorfer, LGC Standards
New Product
Supplier:  AMBEED, INC
Description:   Methyl 6-bromo-5-fluoropyridine-2-carboxylate 98%
Supplier:  AMBEED, INC
Description:   5-Chloro-2-iodo-m-xylene 97%
New Product
Supplier:  LGC STANDARDS
Description:   Ethyl 2-[2-[(2,6-Dichlorophenyl)amino]phenyl]acetate (Ethyl Ester of Diclofenac), Mikromol, LGC Standards
New Product
Supplier:  TCI America
Description:   CAS Number: 106-24-1
MDL Number: MFCD00002917
Molecular Formula: C10H18O
Molecular Weight: 154.25
Purity/Analysis Method: >96.0% (GC)
Form: Clear Liquid
Boiling point (°C): 230
Melting point (°C): -15
Flash Point (°C): 112
Specific Gravity (20/20): 0.88
MSDS SDS
Supplier:  Corning
Description:   PMP, translucent, with tapered PP stopper.
Product available on GSA Advantage®
Catalog Number: (AAL13266-ND)

Supplier:  Thermo Scientific Chemicals
Description:   Fieser: 1,935 12,407 13,257 14,265 17,290 18,299 19,276 21,360
Supplier:  Thermo Scientific Chemicals
Description:   PBDB-T-2Cl, Poly[[4, 8-bis[4-chloro-5-(2-ethylhexyl)-2-thienyl]benzo[1,2-b:4,5-b']dithiophene-2,6-diyl]-2,5-thiophenediyl[5,7-bis(2-ethylhexyl)-4,8-dioxo-4H,8H-benzo[1,2-c:4,5-c]dithiophene-1,3-diyl]-2,5-thiophenediyl], Synonyms: PCE 139, Formula: (C68H76Cl2O2S8)n, Storage: Ambient, Size: 500mg
Supplier:  AOB CHEM USA
Description:   2-Fluoro-4-(4-(trifluoromethoxy)phenyl)pyridine ≥97%
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
7,201 - 7,216  of 139,837