Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results


SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"0"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  AMBEED, INC
Description:   N-(3,3-Dimethylindolin-6-yl)-2-((pyridin-4-ylmethyl)amino)nicotinamide diphosphate, Purity: 98%, CAS Number: 857876-30-3, Appearance: White solid, Storage: Inert atmosphere, Store in freezer, under -20 C, Size: 5mg
Supplier:  AMBEED, INC
Description:   (R)-2-((tert-Butoxycarbonyl)amino)-3-methoxypropanoic acid, Purity: 97%, CAS Number: 86123-95-7, Appearance: White to off white solid or liquid, Storage: Sealed in dry, 2-8C, Size: 25G
Catalog Number: (10072-172)

Supplier:  Prosci
Description:   HCC-1 is a CC chemokine that signals through the CCR1 receptor and chemoattracts blood monocytes. It is secreted by various tissues including skeletal muscle, heart, spleen, liver, bone marrow and plasma. Mature HCC-1 is found in four different forms, which are distinguished by differential N-terminal truncation and contain 74, 72, 71, or 66 amino acid residues. Recombinant human HCC-1 (66 a.a.) is a 7.8 kDa protein consisting of 66 amino acids including the four highly conserved residues present in CC chemokines.
Supplier:  Bachem Americas
Description:   Sequence: H-3-Iodo-Tyr-OH
Supplier:  AMBEED, INC
Description:   N2,Nd,Nw-tris(tert-butoxycarbonyl)-L-arginine 95%
Catalog Number: (103003-054)

Supplier:  Anaspec Inc
Description:   This core region of human amylin, corresponding to amino acid residues 20 to 29, forms amyloid-like fibrils that display polymorphic structures.
Sequence: SNNFGAILSS
MW: 1009.1 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C
Catalog Number: (10080-770)

Supplier:  Prosci
Description:   Polyclonal, Host: Rabbit, Species reacivity: human, Immunogen: Synthetic 15 amino acid peptide from cytoplasmic domain of human SLC39A14, Tested application: IHC
Catalog Number: (103007-122)

Supplier:  Anaspec Inc
Description:   This is the hydrophobic C-terminal fragment of b-Amyloid peptide amino acids 22 to 42.
Sequence: EDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 1999.4 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Supplier:  Bachem Americas
Description:   Sequence: Fmoc-7-aminoheptanoic acid
Supplier:  AMBEED, INC
Description:   Nα-Fmoc-Nω-(p-toluenesulfonyl)-L-arginine 97%
Supplier:  AMBEED, INC
Description:   N-[(9H-Fluoren-9-ylmethoxy)carbonyl]-L-2-phenylglycine 97%

Supplier:  Anaspec Inc
Description:   This peptide is PACAP (1-38) with a Biotin label on its N-terminus. Pituitary adenylate cyclase-activating polypeptide (PACAP), a member of the vasoactive intestinal peptide/secretin/glucagon family, has an amino acid sequence identity of 68% with vasoactive intestinal polypeptide (VIP). PACAP38, derived from a 176-amino acid precursor (preproPACAP), is a 38-amino acid peptide discovered as an ovine hypothalamic neuropeptide. The amino acid sequence of PACAP is identical in all mammals, and in species such as chicken, frog, salmon, only 1–3 amino acids are different. It is abundant in both the central and peripheral nervous systems and exerts a variety of effects. PACAP in pancreatic islets may play a parasympathetic and sensory neurotransmitter role. PACAP stimulates insulin secretion from islets in a glucose-dependent manner at femtomolar concentrations, acting as an insulinotropic factor. PACAP and VIP are two multifunctional neuropeptides modulating innate and adaptive immunity. VIP/PACAP protect T cells from activation-induced cell death through down-regulation of Fas ligand. PACAP immunoreactivity has been shown in nerve fibers innervating the intrapancreatic ganglia as well as the islets of Langerhans in pancreas. PACAP (1-38) is more active than VIP in stimulating adenylate cyclase EC50=7 nM.
Sequence: HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKK(Biotin)-NH2
MW: 4888.8 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Catalog Number: (77138-614)

Supplier:  AMBEED, INC
Description:   (1S,2S)-2-((((9H-Fluoren-9-yl)methoxy)carbonyl)amino)cyclopentanecarboxylic acid, Purity: 95%, CAS Number: 359586-64-4, Appearance: White to off-white powder or crystals, Storage: Sealed in dry, 2-8 deg C, Size: 250mg
Catalog Number: (89152-706)

Supplier:  Enzo Life Sciences
Description:   Anti-inflammatory and anti-angiogenic
Catalog Number: (ALA151515-5G)

Supplier:  ALADDIN SCIENTIFIC
Description:   3-Amino-5-phenylpyrazole ((3-phenyl-1H-pyrazol-5-amine) may be used in the synthesis of the following: · Urea derivatives by reaction with azido(6-(benzofuran-2-yl)-2-methylpyridin-3-yl) methanone. · 2-Mercaptoacetamide analogs by treating with thioglycolic acid. · 3-(Substituentpyrimidayl)-5,6-benzocoumarins by treating with 3-(2′-formyl-1′-chlorovinyl)-5,6-benzocoumarin. · Substituted 2,7-diphenylpyrazolo[1,5-a]pyrimidine-5-carboxylic esters by reacting with substituted β-diketo esters. · N-ethoxycarbonylthiourea derivative by reacting with ethoxycarbonyl isothiocyanate. · Heterobiaryl pyrazolo[3,4-b]pyridines by reacting with indole-3-carboxaldehyde.
New Product
Catalog Number: (76485-764)

Supplier:  AAT BIOQUEST INC
Description:   Compared to the commonly used DNP-X acid (#2020), DNP-PEG4 acid has much better water solubility.
Small Business Enterprise Minority or Woman-Owned Business Enterprise
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
257 - 0  of 0