Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

4,4\'-(Hexafluoroisopropylidene)dianiline


150,566  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"150566"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Catalog Number: (10114-454)

Supplier:  Prosci
Description:   Polyclonal, Host: Goat; Target Species: Human; Immunogen: SDF4 antibody was raised against a 15 amino acid synthetic peptide near the internal region of SDF4 (aa 161-175); Applications: ELISA,Western blotting
Catalog Number: (10081-394)

Supplier:  Proteintech
Description:   Anti-PPP1R13L(Polyclonal) Antibody, Host Species: Rabbit, Cross Reactivity: Human, Immunogen: Recombinant Protein, 1-240 amino acid, Format:Antigen affinity purification, Application: ELISA, WB, IHC, Recommended Storage: - 20 C or lower
Supplier:  Bachem Americas
Description:   Sequence: H-β-Cyclopropyl-Ala-OH
Catalog Number: (10102-784)

Supplier:  Prosci
Description:   Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and inner-membrane mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology.Glutamic-oxaloacetic transaminase is a pyridoxal phosphate-dependent enzyme which exists in cytoplasmic and inner-membrane mitochondrial forms, GOT1 and GOT2, respectively. GOT plays a role in amino acid metabolism and the urea and tricarboxylic acid cycles. The two enzymes are homodimeric and show close homology. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Catalog Number: (10100-010)

Supplier:  Prosci
Description:   GPT and GPT2 (EC 2.6.1.2), also known as alanine transaminases, are pyridoxal enzymes that catalyze the reversible transamination between alanine and 2-oxoglutarate to form pyruvate and glutamate. By mediating the conversion of these 4 major intermediate metabolites, these transaminases have roles in gluconeogenesis and in amino acid metabolism.GPT (MIM 138200) and GPT2 (EC 2.6.1.2), also known as alanine transaminases, are pyridoxal enzymes that catalyze the reversible transamination between alanine and 2-oxoglutarate to form pyruvate and glutamate. By mediating the conversion of these 4 major intermediate metabolites, these transaminases have roles in gluconeogenesis and in amino acid metabolism.
Catalog Number: (10113-268)

Supplier:  Prosci
Description:   Polyclonal, Host: Goat, Species Reactivity: Human, Immunogen: CPT1A antibody was raised against a 14 amino acid synthetic peptide near the internal region of CPT1A, Tested Applications: ELISA, WB, IHC
Catalog Number: (10115-428)

Supplier:  Prosci
Description:   Polyclonal antibody KLRK1 Host: Goat Target Species: human immunogen: KLRK1 antibody was raised against a 12 amino acid synthetic peptide near the internal region of KLRK1. Application: ELISA, WB
Catalog Number: (10113-930)

Supplier:  Prosci
Description:   Polyclonal, Host: Goat, Species Reactivity: Human, Mouse, Immunogen: MC5R antibody was raised against a 12 amino acid synthetic peptide near the N-Terminus (near) of MC5R (near), Tested Applications: ELISA
Catalog Number: (10115-784)

Supplier:  Prosci
Description:   Polyclonal antibody CLPP Host: Goat Target Species: human immunogen: CLPP antibody was raised against a 13 amino acid synthetic peptide near the C-Terminus of CLPP. Application: ELISA, WB, IHC
Catalog Number: (10115-814)

Supplier:  Prosci
Description:   Polyclonal antibody CREB3L4 Host: Goat Target Species: human immunogen: CREB3L4 antibody was raised against a 14 amino acid synthetic peptide near the C-Terminus of CREB3L4. Application: ELISA, WB, IHC
Supplier:  TCI America
Description:   CAS Number: 495-69-2
MDL Number: MFCD00002692
Molecular Formula: C9H9NO3
Molecular Weight: 179.18
Purity/Analysis Method: >98.0% (T)
Form: Crystal
Melting point (°C): 190
MSDS SDS
Catalog Number: (103006-440)

Supplier:  Anaspec Inc
Description:   This peptide is from amino acid 3-42 of the full length 42-amino acid long GIP (Glucose-dependent Insulinotropic Polypeptide or also known as Gastric Inhibitory Polypeptide). The in-vivo degradation of the first two N-terminal amino acids (Tyr-Ala) by the enzyme dipeptidyl peptidase IV (DPP IV) results in making GIP (3-42) a potent antagonist as opposed to the agonist full length GIP on the GIP receptor.
Sequence: EGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
MW: 4759.4 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Supplier:  MP Biomedicals
Description:   Trypan blue is a blue acid dye with a strong affinity for cellulose containing substrates such as cotton; less affinity for proteinaceous materials.
MSDS SDS
Supplier:  Enzo Life Sciences
Description:   Produced in <i>E. coli.</i> Contains 130 amino acids.
Supplier:  Sino Biological
Description:   plaa2 Recombinant Protein, Host: HEK293 Cells, Species: Platanus acerifolia, Purity: > 90 %, MW: Consists of 383 amino acids and predicts a molecular mass of 40.7 kDa, Synonyms: Platanus acerifolia (London plane tr
Supplier:  MP Biomedicals
Description:   Desmosine is prepared according to the method of Starcher et al. from hydrolysed neck ligament by solvent extraction and chromatography on Dowex 50.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
-31 - -16  of 150,566
Prev   1  2  3  4  5  6  7  8  9  10  11  12  13  14  15  Next