Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results

You Searched For:

5-Ethynylbenzo[d][1,3]dioxole


19,672  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"19672"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Catalog Number: (76655-874)

Supplier:  AMBEED, INC
Description:   (R)-4-((S)-1-Fluoroethyl)-3-(2-(((S)-1-(4-methyl-2'-(trifluoromethyl)-[3,4'-bipyridin]-6-yl)ethyl)amino)pyrimidin-4-yl)oxazolidin-2-one, Purity: 98%, CAS Number: 1628805-46-8, Appearance: White to yellow powder or crystals, Storage: Inert atmosphere, 2-8C, Size: 10MG
Supplier:  AMBEED, INC
Description:   3-(3,4-Dimethoxyphenyl)-2-(pyridin-3-yl)acrylonitrile, Purity: 98%, CAS Number: 136831-48-6, Appearance: Pale yellow to yellow powder or crystals, Storage: Keep in dark place, Sealed in dry, 2-8C, Size: 1MG
Supplier:  AMBEED, INC
Description:   Diisopropyl carbonate 98%
Catalog Number: (76707-926)

Supplier:  AFG BIOSCIENCE LLC
Description:   Mouse Interleukin-34(IL34) ELISA Kit
Supplier:  AMBEED, INC
Description:   5-Bromo-1-((2R,3R,4S,5R)-3,4-dihydroxy-5-(hydroxymethyl)tetrahydrofuran-2-yl)pyrimidine-2,4(1H,3H)-dione, Purity: 98%, CAS Number: 957-75-5, Appearance: Form: Crystal - Powder, Storage: Inert atmosphere, Store in freezer, under -20 C, Size: 25g
Supplier:  TCI America
Description:   CAS Number: 1131-62-0
MDL Number: MFCD00008737
Molecular Formula: C10H12O3
Molecular Weight: 180.20
Purity/Analysis Method: >98.0% (GC)
Form: Crystal
Boiling point (°C): 161
Melting point (°C): 49
Flash Point (°C): 110
MSDS SDS

Supplier:  LGC STANDARDS
Description:   3,4-Dihydroxyphenylacetic Acid, TRC, LGC Standards
New Product

Supplier:  LGC STANDARDS
Description:   Quercetin 3,4'-Diglucoside, TRC, LGC Standards
New Product

Supplier:  TCI America
Description:   CAS Number: 133-67-5
MDL Number: MFCD00057315
Molecular Formula: C8H8Cl3N3O4S2
Molecular Weight: 380.64
Purity/Analysis Method: >99.0% (T)
Form: Crystal
Color: White
MSDS SDS
Supplier:  Bachem Americas
Description:   Substrate for human kidney dipeptidase.

Supplier:  Anaspec Inc
Description:   Parathyroid hormone (PTH) regulates the metabolism of calcium and phosphate. PTH and PTH-related polypeptide (PTHrP) play important roles in calcium homeostasis of bone, kidney, breast, and placenta; they signal via the PTH/PTHrP and PTH2 receptors. PTH(1–34) administration suppresses cardiovascular calcification and down-regulates aortic osteogenic programs driven by diabetes and dyslipidemia.
Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFK(Biotin)
MW: 4472.2 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Supplier:  Bachem Americas
Description:   Sequence: L-1,2,3,4-Tetrahydronorharman-3-carboxylic acid

Supplier:  TCI America
Description:   Boron Trichloride (ca. 13% in p-Xylene, ca. 1.0mol/L), Cas number: 10294-34-5, Molecular Formula: BCl3, Molecular Weight: 117.16, Appearance: Colorless - Pale yellow Clear liquid, Storage: 0-10 deg C, Size: 100ML
MSDS SDS
Supplier:  AMBEED, INC
Description:   1-((2'-(2H-Tetrazol-5-yl)-[1,1'-biphenyl]-4-yl)methyl)-5,7-diethyl-3,4-dihydro-1,6-naphthyridin-2(1H)-one hydrochloride 97%
Supplier:  AMBEED, INC
Description:   (2R,3R,4S,5R)-2-(4-Amino-5-iodo-7H-pyrrolo[2,3-d]pyrimidin-7-yl)-5-(hydroxymethyl)tetrahydrofuran-3,4-diol, Purity: 98%, CAS Number: 24386-93-4, Appearance: Form: solid Colour: off-white - beige, Storage: Keep in dark place, Inert atmosphere, 2-8 C, Size: 5mg
Supplier:  AMBEED, INC
Description:   3-(4-Hydroxyphenyl)hex-4-ynoic acid, Purity: 97%, CAS Number: 865233-34-7, Appearance: Solid, Storage: Inert atmosphere, Room Temperature, Size: 1g
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
3,553 - 3,568  of 19,672