Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

4-Ethynyl-1,1\\\'-biphenyl


21,726  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"21726"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  AMBEED, INC
Description:   (4S,4'S,5R,5'R)-2,2'-(Cyclohexane-1,1-diyl)bis(4,5-diphenyl-4,5-dihydrooxazole) ≥97%, ee 99%
New Product

Supplier:  Sino Biological
Description:   This antibody was produced from a hybridoma resulting from the fusion of a mouse myeloma with B cells obtained from a mouse immunized with purified, recombinant Human KLK11 / Kallikrein 11 (rh KLK11 / Kallikrein 11; Catalog#10767-H08H; NP_006844.1; Met1-Asn250). The IgG fraction of the cell culture supernatant was purified by Protein A affinity chromatography.
Catalog Number: (103005-822)

Supplier:  Anaspec Inc
Description:   Post-mortem Alzheimer’s diseased brain specimens reveals significant levels of Aß (11-40/42) within insoluble amyloid pools. The ß-secretase enzyme or ß-amyloid precursor protein-cleaving enzyme (BACE) generates the N terminus of Aß, ultimately leading to the production of full-length Aß (1-40/42) or truncated Aß (11-40/42). The abundance of Aß (11-40/42) produced by BACE suggests that their roles in AD pathogenesis may be important.
Sequence: EVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Molecular Weight: 3151.7 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Supplier:  AMBEED, INC
Description:   (2-Cyclopropyl-4-(4-fluorophenyl)quinolin-3-yl)methanol, Purity: 97%, CAS Number: 121660-11-5, Appearance: White to yellow powder or crystals, Storage: Sealed in dry, 2-8 C, Size: 250mg
Supplier:  AMBEED, INC
Description:   3,3'-Dimethyltriphenylamine, Purity: 98%, CAS Number: 13511-11-0, Appearance: White to Light yellow powder to crystal, Storage: Sealed in dry, Room Temperature, Size: 25g
Supplier:  Thermo Scientific Chemicals
Description:   A tricyclic norepinephrine uptake inhibitor
MSDS SDS
Supplier:  Matrix Scientific
Description:   MF=C9H10CLNO2 MW=199.64 CAS=14091-11-3 MDL=MFCD00037774 5G
Catalog Number: (102545-478)

Supplier:  Matrix Scientific
Description:   MF=C7H5CLO2 MW=156.57 CAS=74-11-3 MDL=MFCD00002531 100G
Supplier:  Novus Biologicals
Description:   Mouse Monoclonal beta 2 Microglobulin, H-2Db antigen Antibody (27-11-13S) [FITC]. Tested Applications: Flow Cytometry, Immunohistochemistry, Immunohistochemistry-Frozen, Immunohistochemistry-Paraffin. Tested Reactivity: Mouse.
Supplier:  AMBEED, INC
Description:   4-(4-Hydroxyphenyl)butanoic acid, Purity: 98%, CAS Number: 7021-11-6, Appearance: White to yellow to brown solid, Storage: Inert atmosphere, Room Temperature, Size: 10G
Supplier:  AMBEED, INC
Description:   2,3-Difluoro-4-methoxybenzaldehyde, Purity: 98+%, CAS Number: 256417-11-5, Appearance: White to Off-white Powder or Crystals, Storage: Inert atmosphere, 2-8C, Size: 5G
Supplier:  TCI America
Description:   CAS Number: 15988-11-1
MDL Number: MFCD00005226
Molecular Formula: C8H7N3O2
Molecular Weight: 177.16
Purity/Analysis Method: >98.0% (T)
Form: Crystal
Color: White
Melting point (°C): 209
MSDS SDS
Supplier:  Restek
Description:   Aluminum seals provide a sturdy cap to crimp-top vials that, when turned, allow for easy removal of the septum.
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 063184-500MG , MDL Number: MFCD13248763
Catalog Number: (TCD1460-100MG)

Supplier:  TCI America
Description:   CAS Number: 89131-11-3
MDL Number: MFCD00059366
Molecular Formula: C19H24N4O4S
Molecular Weight: 404.49
Purity/Analysis Method: >98.0% (HPLC)
Form: Crystal
MSDS SDS
Catalog Number: (89366-296)

Supplier:  Genetex
Description:   Rabbit Polyclonal Antibody to TR2-11
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
5,697 - 5,712  of 21,726