Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

5-(3,5-Dibromophenyl)thiazol-2-amine


39,106  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"39106"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  Matrix Scientific
Description:   MF=C12H9N3O3 MW=243.22 MDL=MFCD11057929 ,500Mg
Catalog Number: (76011-242)

Supplier:  Prosci
Description:   This gene is a member of the regulatory factor X gene family, which encodes transcription factors that contain a highly-conserved winged helix DNA binding domain. The protein encoded by this gene is structurally related to regulatory factors X1, X3, X4, and X5. It is a transcriptional activator that can bind DNA as a monomer or as a heterodimer with other RFX family members. This protein can bind to cis elements in the promoter of the IL-5 receptor alpha gene. Two transcript variants encoding different isoforms have been described for this gene, and both variants utilize alternative polyadenylation sites.
Supplier:  TCI America
Description:   CAS Number: 635-51-8
MDL Number: MFCD00004256
Molecular Formula: C10H10O4
Molecular Weight: 194.19
Purity/Analysis Method: >98.0% (HPLC,T)
Form: Crystal
Melting point (°C): 168
MSDS SDS
Catalog Number: (103008-568)

Supplier:  Anaspec Inc
Description:   This sequence is amino acids 1 to 20 of influenza A virus hemagglutinin protein (HA2) connected to a 10 amino acid cell permeable HIV Trans-Activator of Transcription (TAT) protein transduction domain (PTD). TAT-HA2 is capable of being used as a large macromolecule drug delivery peptide. The TAT PTD binds to the cell surface and penetrates the membrane via lipid raft-dependent macropinocytosis. Endosomal escape and transduction of the fusion peptide are enhanced by the HA2 domain, which is a pH-sensitive lipid membrane destabilizing sequence.
Sequence: RRRQRRKKRGGDIMGEWGNEIFGAIAGFLG
MW: 3433 Da
% Peak area by HPLC: 95
Storage condition: -20°C
Supplier:  TLC PHARMACEUTICAL STANDARD LTD
Description:   Pharmaceutical Standards, Nintedanib E-isomer (Intedanib E-isomer)
Supplier:  Electron Microscopy Sciences
Description:   Fast Green FCF solution is a prepared, ready-to-use, high quality staining solutions for standard staining procedures used by the Biological Staining Commission and the Armed Forces Institute of Pathology
Minority or Woman-Owned Business Enterprise
Supplier:  AMBEED, INC
Description:   (R)-7-(3-Aminoazepan-1-yl)-8-chloro-1-cyclopropyl-6-fluoro-4-oxo-1,4-dihydroquinoline-3-carboxylic acid hydrochloride, Purity: 98%, CAS Number: 405165-61-9, Appearance: Yellow solid, Storage: Inert atmosphere, Room Temperature, Size: 1mg
Supplier:  AMBEED, INC
Description:   (S)-9-Fluoro-3-methyl-10-(4-methylpiperazin-1-yl)-7-oxo-3,7-dihydro-2H-[1,4]oxazino[2,3,4-ij]quinoline-6-carboxylic acid hydrochloride 98%
Supplier:  Matrix Scientific
Description:   MF=C14H19N3O3 MW=277.33 250Mg
Supplier:  AMBEED, INC
Description:   Methyl 1,4-dioxaspiro[4.5]decane-8-carboxylate, Purity: 96%, CAS Number: 26845-47-6, Appearance: Liquid or solid, Storage: Inert atmosphere, Room Temperature, Size: 100G
Supplier:  AMBEED, INC
Description:   5-Amino-7-(cyclohexylamino)-1-ethyl-6-fluoro-4-oxo-1,4-dihydroquinoline-3-carboxylic acid, Purity: 98%, CAS Number: 836620-48-5, Appearance: Light-yellow to yellow to pale-brown powder or crystals, Storage: Keep in dark place, Inert atmosphere, Room temperature, Size: 1mg
Supplier:  AMBEED, INC
Description:   3-Hydroxy-5-nitrobenzoic acid 97%
New Product
Supplier:  Thermo Scientific Chemicals
Description:   250mg CAS: 1149-23-1, MDL: MFCD00005951
MSDS SDS
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 039217-500MG , MDL Number: MFCD12027719
Supplier:  AMBEED, INC
Description:   6-Bromo-2-methyl-3-nitrobenzoic acid, Purity: 97%, CAS Number: 1207341-14-7, Appearance: White to yellow powder or crystals, Storage: Sealed in dry, Room Temperature, Size: 100mg
Supplier:  Thermo Scientific Chemicals
Description:   100g.
MSDS SDS
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
3,729 - 3,744  of 39,106
Prev