Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results


SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"18049"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  Thermo Scientific Chemicals
Description:   97% 50G
MSDS SDS
Catalog Number: (103007-366)

Supplier:  Anaspec Inc
Description:   This is a modified beta-amyloid (1-42) peptide wherein at position 35, the methionine is in an oxidized state. The Methionine residue at position 35 has been shown to be responsible for the oxidative stress and neurotoxic properties both in vitro and in vivo. In addition, Aβ- bearing oxidized Met-35 is found in considerable amounts in post-mortem AD plaques and the accumulation of oxidized Met-35 seems to be related to reduced enzymatic reversal of methionine sulfoxide back to methionine observed in AD brains.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL-M(O)-VGGVVIA
Molecular Weight: 4530.1 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 043556-5G , MDL Number: MFCD02571875
Supplier:  BeanTown Chemical
Description:   CAS: 63370-90-1; MDL No: MFCD01863471 Powder; Molecular Formula: C44H80HfO8 ; MW: 915.60 Melting Point: 315°
MSDS SDS
Supplier:  AMBEED, INC
Description:   (R)-2,2'-Bis[bis(3,5-dimethylphenyl)phosphino]-4,4',6,6'-tetramethoxy-)-1,1'-biphenyl, Purity: 98% 99%ee, CAS Number: 1365531-89-0, Appearance: White to yellow powder or crystals, Storage: Inert atmosphere, Room Temperature, Size: 100mg
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 034694-1G , MDL Number: MFCD11226666
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 020905-500MG , MDL Number: MFCD00030408
Supplier:  TCI America
Description:   CAS Number: 1066-35-9
MDL Number: MFCD00000495
Molecular Formula: C2H7ClSi
Molecular Weight: 94.61
Purity/Analysis Method: >95.0% (GC)
Form: Clear Liquid
Boiling point (°C): 37
Melting point (°C): -111
Flash Point (°C): -20
Specific Gravity (20/20): 0.87
Storage Temperature: 0-10°C
MSDS SDS
Supplier:  AMBEED, INC
Description:   4-Chloro-N-(5-(4-fluorophenyl)-1,3,4-oxadiazol-2-yl)benzamide, Purity: 98+%, CAS Number: 865285-29-6, Appearance: White to beige powder or crystals, Storage: Sealed in dry, 2-8C, Size: 5MG
Supplier:  Bachem Americas
Description:   The neurotoxicity of the short fragment IIGLM is similar to that of amyloid β-protein (1-42) (H-1368). Aβ 31-35 induced apoptosis in undifferentiated PC 12 cells.
Supplier:  TCI America
Description:   CAS Number: 10366-35-5
MDL Number: MFCD00006237
Molecular Formula: C6H5ClN2O
Molecular Weight: 156.57
Purity/Analysis Method: >98.0% (GC)
Form: Crystal
Melting point (°C): 164
MSDS SDS
Supplier:  AMBEED, INC
Description:   5-Bromoresorcinol 97%
Supplier:  AMBEED, INC
Description:   1-(3,5-Difluorophenyl)-2,2,2-trifluoroethanone, Purity: 97%, CAS number: 845823-12-3, Appearance: Solid or liquid, Storage: Sealed in dry, 2-8C, Size: 10G

Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 040400-500MG , MDL Number: MFCD00227067
Supplier:  Matrix Scientific
Description:   MF=C5H5IN2O MW=236.01 CAS=262353-35-5 MDL=MFCD08275719 10G
Supplier:  AMBEED, INC
Description:   Ethyl 2-((3,5-dibromo-4-hydroxyphenyl)(3,5-dibromo-4-oxocyclohexa-2,5-dien-1-ylidene)methyl)benzoate, Purity: 80% for microscopy, CAS Number: 1176-74-5, Appearance: Form: solid, Storage: Keep in dark place, Inert atmosphere, Room temperature, Size: 250mg
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
2,161 - 2,176  of 18,049