2-(2-Methyl-1-piperidinyl)isonicotinic+acid
Supplier:
Matrix Scientific
Description:
Matrix Scientific Part Number: 041625-1G , MDL Number: MFCD02682438
Catalog Number:
(101855-890)
Supplier:
Matrix Scientific
Description:
Matrix Scientific Part Number: 042459-5G , MDL Number: MFCD00235877
Catalog Number:
(103679-206)
Supplier:
Sino Biological
Description:
MAP2K6, Recombinant protein, Purity: > 95 % as determined by SDS-PAGE, Host: Baculovirus-Insect Cells, Species: Human, Molecular Mass: The secreted recombinant human MKK6 consists of 336 amino acids and predicts a molecular mass of 37.6 kDa, Size: 50 ug
Supplier:
HICHROM LIMITED
Description:
Avantor® Partisil® was one of the first commercially available irregular silicas. A large surface area gives it a high loading capacity.
Catalog Number:
(10112-306)
Supplier:
Prosci
Description:
Polyclonal, Host: Goat, Species: Rat, Immunogen: Zcchc11 Antibody was raised against a 15 amino acid sequence near the internal region of Zcchc11 (mouse), Application: ELISA, WB
Catalog Number:
(10112-090)
Supplier:
Prosci
Description:
Polyclonal, Host: Goat, Species: Human, Immunogen: SH2D1A antibody was raised against a 10 amino acid synthetic peptide near the internal region of SH2D1A, Application: ELISA, WB
Catalog Number:
(10362-552)
Supplier:
Bioss
Description:
Sodium-independent, high-affinity transport of large neutral amino acids such as phenylalanine, tyrosine, leucine, arginine and tryptophan, when associated with SLC3A2/4F2hc. Involved in cellular amino acid uptake. Acts as an amino acid exchanger. Involved in the transport of L-DOPA across the blood-brain barrier, and that of thyroid hormones triiodothyronine (T3) and thyroxine (T4) across the cell membrane in tissues such as placenta. Plays a role in neuronal cell proliferation (neurogenesis) in brain. Involved in the uptake of methylmercury (MeHg) when administered as the L-cysteine or D,L-homocysteine complexes, and hence plays a role in metal ion homeostasis and toxicity. Involved in the cellular activity of small molecular weight nitrosothiols, via the stereoselective transport of L-nitrosocysteine (L-CNSO) across the transmembrane. May play an important role in high-grade gliomas. Mediates blood-to-retina L-leucine transport across the inner blood-retinal barrier which in turn may play a key role in maintaining large neutral amino acids as well as neurotransmitters in the neural retina. Acts as the major transporter of tyrosine in fibroblasts.
Supplier:
AMBEED, INC
Description:
(S)-2-Amino-3-(thiazol-4-yl)propanoic acid, Purity: 95%, CAS Number: 119433-80-6, Appearance: Off white to light yellow to yellow solid, Storage: Keep in dark place, Inert atmosphere, Store in freezer, under -20C, Size: 250MG
Supplier:
MP Biomedicals
Description:
Glutamate is a key compound in cellular metabolism. It is the most abundant excitatory neurotransmitter in the vertebrate nervous system. It also serves as the precursor for the synthesis of the inhibitory GABA in GABA-ergic neurons. This reaction is catalyzed by glutamate decarboxylase (GAD), which is most abundant in the cerebellum and pancreas.
Catalog Number:
(101785-900)
Supplier:
Matrix Scientific
Description:
MF=C9H8F3No2 MW=219.16 Cas=261952-26-5 MDL=MFCD01631414 1G
Supplier:
Matrix Scientific
Description:
MF=C23H22N2O3 MW=374.44 CAS=132388-58-0 MDL=MFCD00190757 5G
Catalog Number:
(TCA1290-100G)
Supplier:
TCI America
Description:
CAS Number: 99-31-0
MDL Number: MFCD00002522 Molecular Formula: C8H7NO4 Molecular Weight: 181.15 Purity/Analysis Method: >98.0% (T) Form: Crystal
Catalog Number:
(103632-554)
Supplier:
Sino Biological
Description:
A DNA sequence encoding the 77 amino acid endothelial-cell derived form ofthe mature human IL8 (NP_000575.1) (Ala 23-Ser 99) was fused with the Fc region of human IgG1 at the N-terminus.
Catalog Number:
(103008-568)
Supplier:
Anaspec Inc
Description:
This sequence is amino acids 1 to 20 of influenza A virus hemagglutinin protein (HA2) connected to a 10 amino acid cell permeable HIV Trans-Activator of Transcription (TAT) protein transduction domain (PTD). TAT-HA2 is capable of being used as a large macromolecule drug delivery peptide. The TAT PTD binds to the cell surface and penetrates the membrane via lipid raft-dependent macropinocytosis. Endosomal escape and transduction of the fusion peptide are enhanced by the HA2 domain, which is a pH-sensitive lipid membrane destabilizing sequence.
Sequence: RRRQRRKKRGGDIMGEWGNEIFGAIAGFLG MW: 3433 Da % Peak area by HPLC: 95 Storage condition: -20°C
Catalog Number:
(10072-166)
Supplier:
Prosci
Description:
MDC is a CC chemokine that is produced in B cells, macrophages, monocyte-derived dendritic cells, activated NK cells and CD4 T cells. It signals through the CCR4 receptor. MDC chemoattracts monocytes, dendritic cells and NK cells and exerts HIV suppressive activity. The 67 amino acid form of MDC displays reduced chemoattractant activity but retains HIV suppressive activity. Recombinant human MDC is an 8.0 kDa protein containing 67 amino acid residues including the four highly conserved cysteine residues present in the CC chemokines.
Catalog Number:
(10117-192)
Supplier:
Prosci
Description:
Polyclonal; Host: Goat; Species Reactiviy: Human; Immunogen: GABRB3 antibody was raised against a 12 amino acid synthetic peptide near the internal region of GABRB3; Application: ELISA, IHC
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
![]()
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
![]()
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
|
|||||||||