Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results

You Searched For:

Methyl+2-amino-3,5-difluorobenzoate


123,969  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"123969"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Catalog Number: (101822-986)

Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 026845-500MG , MDL Number: MFCD10687274
Catalog Number: (101414-092)

Supplier:  Teknova
Description:   Kanamycin sulfate is used for the selection of resistant bacteria.
Catalog Number: (EM8.20933.0002)

Supplier:  MilliporeSigma
Description:   3, 5-Dihydroxytoluene, CAS number 504-15-4, Chemical Formula: C7H8O2, Synonyms: 5-Methylresorcinol, Orcinol, for synthesis, 2g

Supplier:  Anaspec Inc
Description:   A 36-amino acid Cl- channel blocker from Leiurus quinquestriatus scorpion venom.
Sequence:MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR-NH2 (Disulfide bridge: 2-19,5-28,16-33,20-35)
MW:3996 Da
% peak area by HPLC:95
Storage condition:-20° C
Supplier:  TCI America
Description:   CAS Number: 84380-10-9
Molecular Formula: C20H29NO13
Molecular Weight: 491.45
Purity/Analysis Method: >90.0% (HPLC)
Form: Crystal
Storage Temperature: <0°C
MSDS SDS

Supplier:  AMBEED, INC
Description:   6-Methyl-1H-indazole-5-boronic acid ≥98%
New Product
Catalog Number: (89150-416)

Supplier:  Enzo Life Sciences
Description:   Fluoroquinolone with broad spectrum antibacterial activity against Gram-positive and Gram-negative bacteria
Supplier:  Diagnostic Biosystems
Description:   This antibody reacts with wild as well as mutant types of P53 protein. It recognizes an epitope in the N-terminus of P53 protein, known to reside between amino acids 35 to 45. This antibody can be demonstrated in 22 to 76% of the colon, stomach, bladder, breast, lung and testes cancers.
Supplier:  AMBEED, INC
Description:   2,6-Difluoro-4-methoxyaniline, Purity: 98%, CAS Number: 151414-47-0, Appearance: Solid or Semi-solid or liquid or lump, Storage: Keep in dark place, Inert atmosphere, Room temperature, Size: 10G
Supplier:  RPI
Description:   Semisynthetic, aminoglycoside antibiotic derived from Kanamycin A.
Supplier:  THERMO FISHER SCIENTIFIC CHEMICALS
Description:   3,3',5,5'-Tetramethylbenzidine (TMB) 99+%
Supplier:  AMBEED, INC
Description:   1-(1-Methyl-1H-imidazol-2-yl)piperazine ≥98%, Ambeed.Inc
New Product
Supplier:  Thermo Scientific Chemicals
Description:   5g CAS: 62965-35-9, MDL: MFCD00065574
MSDS SDS
Catalog Number: (101918-912)

Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 059701-500MG , MDL Number: MFCD09054811
Catalog Number: (H-2502.0500BA)

Supplier:  Bachem Americas
Description:   Vasonatrin peptide is a chimera of atrial natriuretic peptide (ANP) and C-type natriuretic peptide (CNP). Its sequence represents the 22 amino acids of CNP plus the 5 C-terminal amino acids of ANP. It possesses the venodilating actions of CNP, the natriuretic actions of ANP, and unique arterial vasodilating actions associated neither with ANP nor with CNP.

Supplier:  Spectrum Chemicals
Description:   Triethylene Glycol Methyl Ether, also known as TEG or triglycol, is a viscous liquid used in air sanitizer products and as a plasticizer for vinyl, Ungraded products supplied by Spectrum are indicative of a grade suitable for general industrial use or research purposes and typically are not suitable for human consumption or therapeutic use. These materials may or may not have a Certificate of Analysis available.
Small Business Enterprise
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
1,617 - 1,632  of 123,969