Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

2-(3,4-Difluorophenyl)ethanol


151,802  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"151802"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 041228-500MG , MDL Number: MFCD09031179
Catalog Number: (101823-740)

Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 027212-500MG , MDL Number: MFCD00188067
Supplier:  AMBEED, INC
Description:   3-Oxo-3,4-dihydro-2H-benzo[b][1,4]oxazine-5-carboxylic acid 95%
Supplier:  Matrix Scientific
Description:   1-(3,5-Difluorobenzyl)-5-oxopyrrolidine-3-carboxylic acid

Supplier:  AMBEED, INC
Description:   4-Hydroxy-6-methoxyquinoline-2-carboxylic acid, Purity: 95%, CAS number: 91092-95-4, Appearance: Solid, Storage: Sealed in dry, Room Temperature, Size: 250MG
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 041105-250MG , MDL Number: MFCD12028549
Catalog Number: (103007-214)

Supplier:  Anaspec Inc
Description:   This is amino acids 1 to 40 fragment of the beta-amyloid peptide with lysine substituted for glutamic acid at position 22, found in Italian families. The Italian mutation of beta-amyloid 1-40 (E22K) aggregates more rapidly and with more potent neurotoxicity than wild-type beta-amyloid 1-40. The formation of a salt bridge between Lys-22 and Asp-23 in the minor conformer might be a reason why E22K-beta-amyloid 40 is more pathogenic than wild-type beta-amyloid 40.
Sequence: DAEFRHDSGYEVHHQKLVFFAKDVGSNKGAIIGLMVGGVV
Molecular Weight: 4328.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Supplier:  AMBEED, INC
Description:   3-Amino-5-(4-chlorophenyl)thiophene-2-carboxylic acid, Purity: 96%, CAS Number: 187949-86-6, Appearance: White to yellow solid, Storage: Keep in dark place, Inert atmosphere, Room temperature, Size: 25g
Supplier:  Matrix Scientific
Description:   4-Oxo-6-Phenyl-4, 5-Dihydropyrazolo-[1, 5-A]Pyrazine-2-Carboxylic Acid, MF=C13H9N3O3, MW=255.23, CAS=1443978-16-2, 1G
MSDS SDS
Supplier:  AMBEED, INC
Description:   (1S,3R)-Fmoc-3-aminocyclopentane-1-carboxylic acid 95%
New Product
Supplier:  Matrix Scientific
Description:   5-Methyl-4-Phenoxy-Pyrrolo[2, 1-F][1, 2, 4]-Triazine-6-Carboxylic Acid Ethyl Ester, MF=C16H15N3O3, MW=297.32, CAS=1363380-63-5, 1G
MSDS SDS
Supplier:  Matrix Scientific
Description:   7-(Trifluoromethyl)-3,4-dihydro-2H-1,4-benzoxazine-2-carboxylic acid ≥97%
Supplier:  AMBEED, INC
Description:   2-(Trifluoromethoxy)pyridine-3-carboxylic acid, Purity: 95%, CAS Number: 1221171-92-1, Appearance: White to off-white solid, Storage: Inert atmosphere, 2-8 deg C, Size: 100mg

Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 008322-500MG , MDL Number: MFCD00716971
Supplier:  AMBEED, INC
Description:   Imidazo[1,2-a]pyrazine-6-carboxylic acid, Purity: 95%, CAS Number: 788819-82-9, Appearance: Solid, Storage: Sealed in dry, 2-8 C, Size: 250mg
Supplier:  Thermo Scientific Chemicals
Description:   1g CAS: 33763-20-1, MDL: MFCD00141955
MSDS SDS
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
6,769 - 6,784  of 151,802
Prev   400