Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results

You Searched For:

Ethyl+5-bromo-\\u03B1-oxobenzo[b]thiophene-2-acetate


73,272  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"73272"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 044401-5G , MDL Number: MFCD01114582
Supplier:  Bachem Americas
Description:   Sequence: 4-Methyl-benzhydrylamine resin (100-200 mesh) · HCl
Synonym(s): MBHA resin · HCl#4-CH₃-Ph-CH(NH₂)-Ph-polymer · HCl
Supplier:  AMBEED, INC
Description:   (1R,3R)-Methyl 1-(benzo[d][1,3]dioxol-5-yl)-2,3,4,9-tetrahydro-1H-pyrido[3,4-b]indole-3-carboxylate hydrochloride, Purity: 97% HPLC, CAS Number: 171752-68-4, Appearance: Solid, Storage: Inert atmosphere, Room Temperature, Size: 25G
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 012548-5G , MDL Number: MFCD06245496
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 043458-5G , MDL Number: MFCD01114577
Supplier:  AMBEED, INC
Description:   1-O-Acetyl-2,3,5-tri-O-benzoyl-β-D-ribofuranose 98%
Catalog Number: (TS46106-0050)

Supplier:  THERMO FISHER SCIENTIFIC CHEMICALS
Description:   Gemcitabine hydrochloride 98%
Catalog Number: (101821-490)

Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 026043-500MG , MDL Number: MFCD00012998
Catalog Number: (IC15910110)

Supplier:  MP Biomedicals
Description:   Doxorubicin hydrochloride is a chemotherapeutic, antitumor, immunosuppressive and antibiotic agent
MSDS SDS
Supplier:  LGC STANDARDS
Description:   Camfetamine Hydrochloride (N-Methyl-3-phenylnorbornan-2-amine Hydrochloride) 1.0 mg/ml in Methanol (as free base), LoGiCal, LGC Standards
New Product
Supplier:  TCI America
Description:   CAS Number: 26774-88-9
MDL Number: MFCD00137746
Molecular Formula: C8H11NO2
Molecular Weight: 153.18
Purity/Analysis Method: >97.0% (T)
Form: Crystal
Specific rotation [a]20/D: -155 deg (C=1, 1mol/L HCl)
MSDS SDS
Catalog Number: (77627-020)

Supplier:  AMBEED, INC
Description:   Curcubitacin E 98+%
New Product
Supplier:  MilliporeSigma
MSDS SDS
Supplier:  AMBEED, INC
Description:   H-3-D-Pal-OH.HCl, Purity: 95%, CAS Number: 350228-35-2, Appearance: White to yellow powder or crystals, Storage: Inert atmosphere, Room Temperature, Size: 1g
Catalog Number: (103008-246)

Supplier:  Anaspec Inc
Description:   Pramlintide is the first in the new class of amylinomimetic compounds and is a synthetic analogue of the human hormone Amylin, a 37 amino acid peptide. Pramlintide’s peptide sequence differs from Amylin by replacing proline at postitions 25, 28, and 29. Pramlintide has a disulfide bridge between C2 and C7. For Research Use Only.
Sequence: KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-NH2 (S-S Bond) acetate salt
MW: 3949.5 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 045586-5G , MDL Number: MFCD00231881
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
5,361 - 5,376  of 73,272