Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results


SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"0"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Catalog Number: (76758-572)

Supplier:  Prosci
Description:   Anti-AME-133v Recombinant Antibody
Supplier:  AAT BIOQUEST INC
Description:   This Live or Deadâ„¢cell viability uses two fluorogenic indicators: calcein AM for viable cells and a cell-impermeable DNA-binding dye for the cells with compromised membranes.
Small Business Enterprise Minority or Woman-Owned Business Enterprise
Supplier:  Bioss
Description:   AM and PAMP are potent hypotensive and vasodilatator agents. Numerous actions have been reported most related to the physiologic control of fluid and electrolyte homeostasis. In the kidney, am is diuretic and natriuretic, and both am and pamp inhibit aldosterone secretion by direct adrenal actions. In pituitary gland, both peptides at physiologically relevant doses inhibit basal ACTH secretion. Both peptides appear to act in brain and pituitary gland to facilitate the loss of plasma volume, actions which complement their hypotensive effects in blood vessels.
Catalog Number: (103003-156)

Supplier:  Anaspec Inc
Description:   AM (22-52) is known as an adrenomedullin receptor antagonist and a cardiac depressant factor, although there is some discrepancy in the literature regarding the selectivity of ADM 22-52 as adrenomedullin receptor antagonist.
Sequence:TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2
MW:3576 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Supplier:  Berkshire
Description:   MicroSeal SuperSorb® AS for Aerospace is a high sorbency, ultrasonically sealed edge cleanroom laundered two-ply wiper that meets AMS 3819D, Class 4, Grade A, Form 1 requirements.
Supplier:  AMBEED, INC
Description:   WHI-P154 98%
Supplier:  Thermo Scientific Chemicals
Description:   25G
MSDS SDS
Catalog Number: (76483-382)

Supplier:  AAT BIOQUEST INC
Description:   Metal Fluorâ„¢ Zn-520 is designed for detection of higher zinc ion concentrations that are present in synaptic vesicles and released in response to electrical stimulation or excitotoxic agonists (0.05 to 50 µM) with minimal interfering calcium sensitivity.
Small Business Enterprise Minority or Woman-Owned Business Enterprise
Catalog Number: (76482-986)

Supplier:  AAT BIOQUEST INC
Description:   Pluronic® F-127 is a nonionic surfactant that is 100% active and relatively non-toxic to cells, and frequently used with dye AM esters to improve their water solubility.
Small Business Enterprise Minority or Woman-Owned Business Enterprise

Supplier:  Bioss
Description:   AM and PAMP are potent hypotensive and vasodilatator agents. Numerous actions have been reported most related to the physiologic control of fluid and electrolyte homeostasis. In the kidney, am is diuretic and natriuretic, and both am and pamp inhibit aldosterone secretion by direct adrenal actions. In pituitary gland, both peptides at physiologically relevant doses inhibit basal ACTH secretion. Both peptides appear to act in brain and pituitary gland to facilitate the loss of plasma volume, actions which complement their hypotensive effects in blood vessels.

Supplier:  Bioss
Description:   AM and PAMP are potent hypotensive and vasodilatator agents. Numerous actions have been reported most related to the physiologic control of fluid and electrolyte homeostasis. In the kidney, am is diuretic and natriuretic, and both am and pamp inhibit aldosterone secretion by direct adrenal actions. In pituitary gland, both peptides at physiologically relevant doses inhibit basal ACTH secretion. Both peptides appear to act in brain and pituitary gland to facilitate the loss of plasma volume, actions which complement their hypotensive effects in blood vessels.
Supplier:  AAT BIOQUEST INC
Description:   CytoCalceinâ„¢ Violet 450 is designed for labeling live cells in the same way to calcein, AM.
Small Business Enterprise Minority or Woman-Owned Business Enterprise

Supplier:  Biolegend
Description:   Purified anti-mouse IgDa [AMS-9.1]; Isotype: Mouse (SJL) IgG2b, κ; Reactivity: Mouse; Apps: FC; Size: 500 μg
Supplier:  ALADDIN SCIENTIFIC
Description:   1-((3-(4-Chlorophenethyl)-1,2,4-oxadiazol-5-yl)methyl)-7-methyl-1H-purin-6(7H)-one ≥98% (by HPLC), Moligandâ„¢
New Product

Supplier:  Bioss
Description:   Transports the calcitonin gene-related peptide type 1 receptor (CALCRL) to the plasma membrane. Acts as a receptor for adrenomedullin (AM) together with CALCRL.
Supplier:  Wearwell
Description:   Combats fatigue while providing a top to bottom anti-microbial solution.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
4,065 - 0  of 0
Prev   1  2  3  4  5  6  7  8  9  10  11  12  13  14  15