Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

3,4-Bis(1-methylethoxy)benzoic+acid


149,040  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"149040"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  Spectrum Chemicals
Description:   Dioctyl Phthalate is an organic compound and included in the class of phthalates which are used as plasticizers. It is a colorless liquid and the diester of phthalic acid. It is not soluble in water but is soluble in oil and finds use as a solvent in glow sticks.. Ungraded products supplied by Spectrum are indicative of a grade suitable for general industrial use or research purposes and typically are not suitable for human consumption or therapeutic use. These materials may or may not have a Certificate of Analysis available.
Supplier:  Bachem Americas
Description:   Sequence: N-Me-Aib-OH
Synonym(s): N-Me-α-Me-Ala-OH
Supplier:  AMBEED, INC
Description:   3-Hydroxy-N'-(2,4,5-trihydroxybenzylidene)-2-naphthohydrazide, Purity: 98+%, CAS Number: 1256493-34-1, Appearance: Yellow solid, Storage: Keep in dark place, Inert atmosphere, 2-8 C, Size: 50mg
Supplier:  AMBEED, INC
Description:   (((2R,3S,4R,5R)-5-(6-Amino-9H-purin-9-yl)-3,4-dihydroxyoxolan-2-yl)methoxy)(((((2R,3S,4S)-5-(7,8-dimethyl-2,4-dioxo-2H,3H,4H,10H-benzo[g]pteridin-10-yl)-2,3,4-trihydroxypentyl)oxy)(hydroxy)phosphoryl)oxy)phosphinic acid ≥98%
New Product
Supplier:  AMBEED, INC
Description:   (S)-2,5-Bis((((9H-fluoren-9-yl)methoxy)carbonyl)amino)pentanoic acid, Purity: 95%, CAS number: 201046-59-5, Appearance: Solid, Storage: Keep in dark place, Inert atmosphere, Room temperature, Size: 250MG
Supplier:  AMBEED, INC
Description:   Bis(NHS)PEG₉ 98%
New Product

Supplier:  Anaspec Inc
Description:   Glucagon-like peptide-2 (GLP-2) promotes nutrient absorption via expansion of the mucosal epithelium by stimulation of crypt cell proliferation and inhibition of apoptosis in the small intestine. It also reduces epithelial permeability, and decreases meal-stimulated gastric acid secretion and gastrointestinal motility. GLP-2 promotes the expansion of the intestinal epithelium through stimulation of the GLP-2 receptor, a member of the glucagon-secretin G protein-coupled receptor superfamily.
Sequence: HADGSFSDEMNTILDNLAARDFINWLIQTKITDR
MW: 3922.4 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Supplier:  AMBEED, INC
Description:   1-((1R,3R,4R,7S)-1-((Bis(4-methoxyphenyl)(phenyl)methoxy)methyl)-7-hydroxy-2,5-dioxabicyclo[2.2.1]heptan-3-yl)-5-methylpyrimidine-2,4(1H,3H)-dione ≥98%
New Product
Catalog Number: (TS40266-0050)

Supplier:  THERMO FISHER SCIENTIFIC CHEMICALS
Description:   Bis(2,4,6-trichlorophenyl)oxalate 98%
Catalog Number: (76483-116)

Supplier:  AAT BIOQUEST INC
Description:   BAPTA AM is cell-permeable version of BAPTA (1,2-bis(o-aminophenoxy)ethane-N,N,N',N'-tetraacetic acid), a cell-permeable calcium chelator.
Small Business Enterprise Minority or Woman-Owned Business Enterprise
Supplier:  G-Biosciences
Description:   Molecular weight: 302.37
MSDS SDS
Supplier:  Thermo Scientific Chemicals
Description:   In disinfectants, magnets, glass, rubber, vulcanization, in fireproofing papers and polymers, and in catalysts
MSDS SDS
Supplier:  TCI America
Description:   CAS Number: 370-81-0
MDL Number: MFCD00001659
Molecular Formula: C14H22N4O2
Molecular Weight: 278.36
Purity/Analysis Method: >98.0% (T)
Form: Crystal
Melting point (°C): 208
MSDS SDS

Supplier:  VWR
Description:   VWR offers an extensive line of acrylamide and bis-acrylamide pre-weighed powder blends, pre-mixed stock solutions, and ready-to-use solutions for customized polyacrylamide gel electrophoresis of proteins and PAGE of nucleic acids. Our ultra pure (> 99.9%) acrylamide and bis-acrylamide powders provide the flexibility to prepare solutions having concentrations and ratios for all electrophoresis applications. Liquid blends minimize the handling of neurotoxic acrylamide.
MSDS SDS
Supplier:  AMBEED, INC
Description:   DIPSO 95%
New Product
Supplier:  THERMO FISHER SCIENTIFIC CHEMICALS
Description:   3,5-Di-tert-butylsalicylic acid 99%
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
4,609 - 4,624  of 149,040