Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

3,5-Bis(4-aminophenoxy)benzoic+acid


149,644  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"149644"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  AMBEED, INC
Description:   (9R,9'R)-4,4'-Dihydroxy-10,10'-dioxo-5,5'-bis(((2S,3R,4S,5S,6R)-3,4,5-trihydroxy-6-(hydroxymethyl)tetrahydro-2H-pyran-2-yl)oxy)-9,9',10,10'-tetrahydro-[9,9'-bianthracene]-2,2'-dicarboxylic acid, Purity: 95%, CAS Number: 81-27-6, Appearance: Form: powder Colour: light yellow - yellow, Size: 1mg
Supplier:  AMBEED, INC
Description:   2,6-Difluoro-4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)benzonitrile, Purity: 97%, CAS number: 1003298-73-4, Appearance: White to off-white powder or crystals, Storage: Inert atmosphere, 2-8C, Size: 10G
Supplier:  TCI America
Description:   [Optical Resolving]
CAS Number: 20445-31-2
MDL Number: MFCD00004184
Molecular Formula: C10H9F3O3
Molecular Weight: 234.17
Purity/Analysis Method: >98.0% (GC,T)
Form: Crystal
Flash Point (°C): 112
Freezing point (°C): 35
Specific rotation [a]20/D: 72 deg (C=2, MeOH)
MSDS SDS

Supplier:  VWR
Description:   EDTA dipotassium salt dihydrate, Ultrapure
MSDS SDS
Supplier:  Biotium
Description:   BCECF, AM ester is membrane-permeant and thus can be loaded into cells via incubation. This product is a mixture of three molecular species, all of which are readily hydrolyzed by endogenous esterases into a single BCECF free acid form once they are in the cells.
Supplier:  AMBEED, INC
Description:   Copper(II) gluconate 98%
Supplier:  Ricca Chemical
Description:   Crystal Violet-Acetic Acid Solution for Cerebrospinal Fluid Cell Count
MSDS SDS
Small Business Enterprise
Supplier:  AOB CHEM USA
Description:   4-Acetyl-3-fluorophenylboronic acid ≥97%
Catalog Number: (89520-514)

Supplier:  Abgent
Description:   Polyclonal antibody, Isotype: Rabbit Ig, Species reactivity: Human, Gene ID: 6129, Target/Specificity: This RPL7 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 6-35 amino acids from the N-terminal region of human RPL7.
Catalog Number: (77157-014)

Supplier:  AMBEED, INC
Description:   (9R,9'S)-4,4'-Dihydroxy-10,10'-dioxo-5,5'-bis(((2S,3R,4S,5S,6R)-3,4,5-trihydroxy-6-(hydroxymethyl)tetrahydro-2H-pyran-2-yl)oxy)-9,9',10,10'-tetrahydro-[9,9'-bianthracene]-2,2'-dicarboxylic acid, Purity: 95%, CAS Number: 128-57-4, Appearance: Light-yellow to yellow powder or crystals, Size: 1mg
Supplier:  Corning
Description:   Trypan Blue is the most common stain used in cell count and viability assays.
Supplier:  Bioss
Description:   G protein-coupled receptors (GPRs), also known as seven transmembrane receptors, heptahelical receptors or 7TM receptors, comprise a superfamily of proteins that play a role in many different stimulus-response pathways. G protein coupled receptors translate extracellular signals into intracellular signals (G protein activation) and they respond to a variety of signaling molecules, such as hormones and neurotransmitters. GPR35 (G protein-coupled receptor 35) is a 309 amino acid multi-pass membrane protein that belongs to the G-protein coupled receptor 1 family. Expressed in adult and fetal tissues, including lung, pancreas, colon and intestine, GPR35 functions as an orphan receptor that is thought to play a role in signaling events throughout the cell.
Catalog Number: (89516-260)

Supplier:  Abgent
Description:   Polyclonal Antibody, Species Reactivity: Human, Mouse, Isotype: Rabbit Ig, Gene ID: 3198, Target/Specificity: This HOXA1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 9-35 amino acids from the N-terminal region of human HOXA1, 1mg
Supplier:  Bachem Americas
Description:   Sequence: H-Hyp-OH

Supplier:  Anaspec Inc
Description:   A 36-amino acid Cl- channel blocker from Leiurus quinquestriatus scorpion venom.
Sequence:MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR-NH2 (Disulfide bridge: 2-19,5-28,16-33,20-35)
MW:3996 Da
% peak area by HPLC:95
Storage condition:-20° C
Supplier:  Bachem Americas
Description:   Sequence: Fmoc-Arg(Me)₂-OH (symmetrical)
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
5,745 - 5,760  of 149,644