Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

Methyl+4-(1-aminocyclopropyl)benzoate+hydrochloride


23,698  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"23698"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 062954-500MG , MDL Number: MFCD04084649
Supplier:  THERMO FISHER SCIENTIFIC CHEMICALS
Description:   Meloxicam 99-101%
Supplier:  Enzo Life Sciences
Description:   Antitumor agent.
Supplier:  TLC PHARMACEUTICAL STANDARD LTD
Description:   Pharmaceutical Standards, Bilastine Impurity 11
Supplier:  AMBEED, INC
Description:   (4S,4'S)-4,4'-Diisopropyl-1,1'-bis(4-(trifluoromethyl)phenyl)-4,4',5,5'-tetrahydro-1H,1'H-2,2'-biimidazole ≥97%
New Product
Supplier:  Matrix Scientific
Description:   (S)-(+)-3, 3'-Bis(3, 5-Bis(Trifluoromethyl)Phenyl)-1, 1'-Binaphthyl-2, 2'-Diyl Hydrogenphosphate, MF=C36H17F12O4P, MW=772.49, CAS=878111-17-2, 1G
MSDS SDS
Catalog Number: (76707-620)

Supplier:  AFG BIOSCIENCE LLC
Description:   Mouse Collectin-11(COLEC11) ELISA Kit
Catalog Number: (76704-536)

Supplier:  AFG BIOSCIENCE LLC
Description:   Human Cadherin-11(CDH11) ELISA Kit
Supplier:  AMBEED, INC
Description:   (4S,4'S,5R,5'R)-2,2'-(Cyclohexane-1,1-diyl)bis(4,5-diphenyl-4,5-dihydrooxazole) ≥97%, ee 99%
New Product
Catalog Number: (103005-822)

Supplier:  Anaspec Inc
Description:   Post-mortem Alzheimer’s diseased brain specimens reveals significant levels of Aß (11-40/42) within insoluble amyloid pools. The ß-secretase enzyme or ß-amyloid precursor protein-cleaving enzyme (BACE) generates the N terminus of Aß, ultimately leading to the production of full-length Aß (1-40/42) or truncated Aß (11-40/42). The abundance of Aß (11-40/42) produced by BACE suggests that their roles in AD pathogenesis may be important.
Sequence: EVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Molecular Weight: 3151.7 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Supplier:  AMBEED, INC
Description:   Sodium (3-amino-1-hydroxypropane-1,1-diyl)bis(hydrogen phosphonate), Purity: 98% (contains H2O), CAS Number: 57248-88-1, Appearance: Form: Crystal - Powder/Colour: White - Almost white, Storage: Inert atmosphere, 2-8 C, Size: 25g

Supplier:  Rockland Immunochemical
Description:   Human Eotaxin AccuSignal ELISA Kit
Supplier:  TCI America
Description:   CAS Number: 35216-11-6
MDL Number: MFCD00041662
Molecular Formula: C14H26
Molecular Weight: 194.36
Purity/Analysis Method: >97.0% (GC)
Form: Clear Liquid
Color: Colorless
Boiling point (°C): 144
Specific Gravity (20/20): 0.79
MSDS SDS
Supplier:  AMBEED, INC
Description:   Methyl 2-aminobenzo[d]thiazole-7-carboxylate, Purity: 98%, CAS number: 209459-11-0, Appearance: Solid, Storage: Keep in dark place, Inert atmosphere, 2-8C, Size: 250MG

Supplier:  Novus Biologicals
Description:   The Myosin heavy chain 11 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Myosin heavy chain 11. This antibody reacts with human. The Myosin heavy chain 11 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry / Immunofluorescence, Immunohistochemistry-Paraffin.
Supplier:  Bon Opus Biosciences
Description:   Bon Opus Biosciences offers quality recombinant proteins products covering a broad collection of cytokines, enzymes, diagnostic and detection reagents, and other protein-related products
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
7,569 - 7,584  of 23,698