Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

Ethyl+2-(2-chloroethoxy)acetate


26,591  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"26591"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 


Supplier:  Ricca Chemical
Description:   Chlorobenzene : acetic acid mixture
Supplier:  AMBEED, INC
Description:   rel-(1R,2R,4S,5S,7s)-9-Methyl-3-oxa-9-azatricyclo[3.3.1.02,4]nonan-7-yl 2-hydroxy-2,2-di(thiophen-2-yl)acetate, Purity: 96%, CAS Number: 136310-64-0, Appearance: White to Yellow Solid, Storage: Keep in dark place, Sealed in dry, 2-8 C, Size: 1mg
Catalog Number: (TCC0085-25ML)

Supplier:  TCI America
Description:   CAS Number: 97-97-2
MDL Number: MFCD00000948
Molecular Formula: C4H9ClO2
Molecular Weight: 124.56
Purity/Analysis Method: >98.0% (GC)
Form: Clear Liquid
Boiling point (°C): 130
Flash Point (°C): 35
Specific Gravity (20/20): 1.09
MSDS SDS
Catalog Number: (101840-692)

Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 036104-500MG , MDL Number: MFCD00004927
Supplier:  AMBEED, INC
Description:   2-(4-Bromo-2-fluorophenyl)acetic acid, Purity: 98%, CAS Number: 114897-92-6, Appearance: White to Pale-yellow to Yellow-brown Solid, Storage: Sealed in dry, Room Temperature, Size: 25g
Catalog Number: (103008-246)

Supplier:  Anaspec Inc
Description:   Pramlintide is the first in the new class of amylinomimetic compounds and is a synthetic analogue of the human hormone Amylin, a 37 amino acid peptide. Pramlintide’s peptide sequence differs from Amylin by replacing proline at postitions 25, 28, and 29. Pramlintide has a disulfide bridge between C2 and C7. For Research Use Only.
Sequence: KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-NH2 (S-S Bond) acetate salt
MW: 3949.5 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C
Catalog Number: (77749-375)

Supplier:  AMBEED, INC
Description:   4-Methylhippuric acid ≥98%
New Product
Supplier:  Matrix Scientific
Description:   Methyl {(4E)-5-oxo-1-phenyl-4-[1-(1H-pyrazol-3-ylamino)ethylidene]-4,5-dihydro-1H-pyrazol-3-yl}acetate
Supplier:  AVANTOR PERFORMANCE MATERIALS US
Description:   For use as an HPLC and TLC solvent. Filtered through a 0.2µm element.
MSDS SDS
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 039194-500MG , MDL Number: MFCD12027698
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 038000-500MG , MDL Number: MFCD12027256
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 036363-500MG , MDL Number: MFCD12026884
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 027571-500MG , MDL Number: MFCD09028265
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 064998-500MG , MDL Number: MFCD06763106

Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 040500-500MG , MDL Number: MFCD10018504
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 039167-500MG , MDL Number: MFCD12027671
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
5,633 - 5,648  of 26,591