Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

4-Methyl-4-(methylthio)-2-pentanone


178,439  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"178439"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 


Supplier:  Bioss
Description:   Receptor for neuropeptide Y and peptide YY. The rank order of affinity of this receptor for pancreatic polypeptides is PYY >NPY >PYY (3-36) >NPY (2-36) >[Ile-31, Gln-34] PP >[Leu-31, Pro-34] NPY >PP, [Pro-34] PYY and NPY free acid.
Supplier:  Bachem Americas
Description:   Sequence: N-Me-Aib-OH
Synonym(s): N-Me-α-Me-Ala-OH

Supplier:  AMBEED, INC
Description:   (S)-2-(((9H-Fluoren-9-yl)methoxy)carbonyl)-2,3,4,9-tetrahydro-1H-pyrido[3,4-b]indole-3-carboxylic acid, Purity: 98%, CAS Number: 204322-23-6, Appearance: White to yellow powder or crystals, Storage: Keep in dark place, Sealed in dry, 2-8C, Size: 5G
Supplier:  AMBEED, INC
Description:   3-Hydroxy-N'-(2,4,5-trihydroxybenzylidene)-2-naphthohydrazide, Purity: 98+%, CAS Number: 1256493-34-1, Appearance: Yellow solid, Storage: Keep in dark place, Inert atmosphere, 2-8 C, Size: 50mg
Supplier:  BeanTown Chemical
Description:   EC No: 214-664-6
MSDS SDS
Supplier:  AMBEED, INC
Description:   (((2R,3S,4R,5R)-5-(6-Amino-9H-purin-9-yl)-3,4-dihydroxyoxolan-2-yl)methoxy)(((((2R,3S,4S)-5-(7,8-dimethyl-2,4-dioxo-2H,3H,4H,10H-benzo[g]pteridin-10-yl)-2,3,4-trihydroxypentyl)oxy)(hydroxy)phosphoryl)oxy)phosphinic acid ≥98%
New Product
Supplier:  MP Biomedicals
Description:   Raffinose is a trisaccharide composed of galactose, fructose, and glucose that is used as carbon source in yeast culture media.

Supplier:  Anaspec Inc
Description:   Glucagon-like peptide-2 (GLP-2) promotes nutrient absorption via expansion of the mucosal epithelium by stimulation of crypt cell proliferation and inhibition of apoptosis in the small intestine. It also reduces epithelial permeability, and decreases meal-stimulated gastric acid secretion and gastrointestinal motility. GLP-2 promotes the expansion of the intestinal epithelium through stimulation of the GLP-2 receptor, a member of the glucagon-secretin G protein-coupled receptor superfamily.
Sequence: HADGSFSDEMNTILDNLAARDFINWLIQTKITDR
MW: 3922.4 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Supplier:  TCI America
Description:   CAS Number: 72040-64-3
MDL Number: MFCD00144853
Molecular Formula: C16H27N3O4S
Molecular Weight: 357.47
Purity/Analysis Method: >97.0% (HPLC,T)
Form: Crystal
Melting point (°C): 230
Storage Temperature: >-20°C
MSDS SDS
Supplier:  MP Biomedicals
Description:   Guanosine is a purine nucleoside comprising guanine attached to a ribose (ribofuranose) ring via a β-N9-glycosidic bond. Guanosine can be phosphorylated to become guanosine monophosphate (GMP), cyclic guanosine monophosphate (cGMP), guanosine diphosphate (GDP), and guanosine triphosphate (GTP). These forms play important roles in various biochemical processes such as synthesis of nucleic acids and proteins, photosynthesis, muscle contraction and intracellular signal transduction (cGMP). When guanine is attached by its N9 nitrogen to the C1 carbon of adeoxyribose ring it is known as deoxyguanosine.
Guanosine is required for an RNA splicing reaction in mRNA, when a "self-splicing" intron removes itself from the mRNA message by cutting at both ends, re-ligating, and leaving just the exons on either side to be translated into protein. The antiviral drug aciclovir, often used in herpes treatment, is structurally similar to guanosine.
MSDS SDS
Supplier:  BeanTown Chemical
Description:   CAS: 98-88-4; EC No: 202-710-8; MDL No: MFCD00000653 UN No: UN1736; Haz Class: 8; Packing Group: II Liquid; Molecular Formula: C7H5ClO; MW: 140.57 Melting Point: -1°; Boiling Point: 198°; Flash point: 72°C (162°F) Density (g/mL): 1.211; Refractive Index: 1.553 Moisture Sensitive
MSDS SDS
Supplier:  AMBEED, INC
Description:   3-Aminobenzhydrazide 98%
Catalog Number: (89139-648)

Supplier:  Biotium
Description:   is a water-soluble B-complex vitamin. Biotin is a coenzyme in the metabolism of fatty acids and leucine, and it plays a role in gluconeogenesis.
Supplier:  Honeywell Research Chemicals
Description:   TraceSELECT™ Ultra and TraceSELECT
MSDS SDS
Supplier:  TCI America
Description:   CAS Number: 41340-25-4
MDL Number: MFCD00133313
Molecular Formula: C17H21NO3
Molecular Weight: 287.36
Purity/Analysis Method: >98.0% (HPLC,T)
Form: Crystal
Melting point (°C): 148
Storage Temperature: 0-10°C
MSDS SDS
Supplier:  Sino Biological
Description:   A DNA sequence encoding the human IL34 (AAH29804.1) (Met1-Pro242) was expressed with a polyhistidine tag at the C-terminus.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
6,337 - 6,352  of 178,439