Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

Methyl+2-(2,5-dioxoimidazolidin-4-yl)acetate


190,304  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"190304"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  MilliporeSigma
Description:   Tributyltin hydride for synthesis
MSDS SDS
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 018341-100G , MDL Number: MFCD00005473
Catalog Number: (103008-246)

Supplier:  Anaspec Inc
Description:   Pramlintide is the first in the new class of amylinomimetic compounds and is a synthetic analogue of the human hormone Amylin, a 37 amino acid peptide. Pramlintide’s peptide sequence differs from Amylin by replacing proline at postitions 25, 28, and 29. Pramlintide has a disulfide bridge between C2 and C7. For Research Use Only.
Sequence: KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-NH2 (S-S Bond) acetate salt
MW: 3949.5 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C
Supplier:  TCI America
Description:   CAS Number: 87413-09-0
MDL Number: MFCD00130127
Molecular Formula: C13H13IO8
Molecular Weight: 424.14
Purity/Analysis Method: >95.0% (T)
Form: Crystal
Melting point (°C): 124
Storage Temperature: <0°C
MSDS SDS
Supplier:  AMBEED, INC
Description:   2-(Trifluoromethyl)-DL-phenylglycine 98%
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 043495-500MG , MDL Number: MFCD00701883
Supplier:  VWR
Description:   3-(4,5-Dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide (MTT), Ultrapure
MSDS SDS
Supplier:  AMBEED, INC
Description:   (4-Chlorophenyl)acetic acid ethyl ester 95%
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 023909-500MG , MDL Number: MFCD05666827
Catalog Number: (102838-978)

Supplier:  Matrix Scientific
Description:   2,5-Dimethylphenylacetyl chloride ≥97%
Supplier:  AMBEED, INC
Description:   (3,4-Dimethoxyphenyl)acetic acid 98%
Supplier:  AMBEED, INC
Description:   1-O-Acetyl-2,3,5-tri-O-benzoyl-β-D-ribofuranose 98%
Supplier:  TCI America
Description:   Ethyl 2-(2-Amino-4-Thiazolyl)-2-Oxoacetate, Purity: >96.0%(HPLC)(T), Cas no: 64987-08-2, Molecular formula : C7H8N2O3S, Molecular weight : 200.21, Synonyms: 2-(2-Amino-4-thiazolyl)-2-oxoacetic Acid Ethyl Ester, Size: 25G
Catalog Number: (82021-512)

Supplier:  G-Biosciences
Description:   Molecular biology universal kit, contains 25 ml each of ammonium acetate, calcium chloride, EDTA, lithium acetate, magnesium chloride, potassium acetate, potassium chloride, SDS, sodium chloride, TE, Tris pH 7,0 and Tris pH 8,0
Supplier:  Hardy Diagnostics
Description:   For the identification and differentiation of Campylobacter, Wolinella and Helicobacter.
Product available on GSA Advantage®
Supplier:  MilliporeSigma
Description:   (Phosphocreatine, sodium). White solid. Purity: >98% by TLC. Contaminants: inorganic phosphate: <= 0.2%. Soluble in H2O. CAS 19333-65-4, M.W. 255.1.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
3,089 - 3,104  of 190,304