Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results

You Searched For:

4-(p-Tolyl)butyric+acid


18,386  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"18386"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  Matrix Scientific
Description:   4-Phenylbutyraldehyde ≥97%
Supplier:  TCI America
Description:   CAS Number: 40912-11-6
MDL Number: MFCD00059305
Molecular Formula: C12H14O4
Molecular Weight: 222.24
Purity/Analysis Method: >98.0% (T)
Form: Crystal
Melting point (°C): 33
Storage Temperature: 0-10°C
MSDS SDS
Supplier:  Chem Impex International
Supplier:  AOB CHEM USA
Description:   3-Acetyl-4-fluorobenzaldehyde ≥97%

Supplier:  Novus Biologicals
Description:   Kallikrein 11 Polyclonal Antibody, Host: Goat, Isotype: IgG, Species reactivity: Human, Conjugate: Biotin, Immunogen: Mouse myeloma cell line NS0-derived recombinant human Kallikrein 11, Synonyms: EC 3.4.21, Application: Western Blot, Size: 50UG
Supplier:  Biolegend
Description:   PE anti-mouse CD90.2 [30-H12]; Isotype: Rat IgG2b, κ; Reactivity: Mouse, Does not react with Thy-1.1 (CD90.1); Apps: FC; Size: 200 μg
Supplier:  BeanTown Chemical
Description:   CAS: 629-11-8; EC No: 211-074-0; MDL No: MFCD00002985; RTECS: MO2100000 Flakes; Linear Formula: HO(CH2)6OH; Molecular Formula: C6H14O2; MW: 118.17 Melting Point: 38-42°; Boiling Point: 250°; Flash point: 102°C (216°F) Hygroscopic
MSDS SDS
Catalog Number: (101914-686)

Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 058376-500MG , MDL Number: MFCD00009048
Supplier:  Thermo Scientific Chemicals
MSDS SDS
Supplier:  TLC PHARMACEUTICAL STANDARD LTD
Description:   Pharmaceutical Standards, Pitavastatin Impurity 11 (Mixture of Diastereomers)
Catalog Number: (TCD0231-025G)

Supplier:  TCI America
Description:   CAS Number: 60-11-7
MDL Number: MFCD00008308
Molecular Formula: C14H15N3
Molecular Weight: 225.30
Form: Crystal
Color: Reddish Yellow
Melting point (°C): 114
Lambda max.: 513 nm (pH2.4)
MSDS SDS
Supplier:  AMBEED, INC
Description:   (3aR,8aS)-2-(Quinolin-2-yl)-3a,8a-dihydro-8H-indeno[1,2-d]oxazole, Purity: 97% 99%ee, CAS Number: 2095128-11-1, Appearance: Pale yellow to yellow powder or crystals, Storage: Inert atmosphere, 2-8C, Size: 100MG

Supplier:  Harvard Apparatus
Description:   The Pump 11 Elite is an accurate, low flow syringe pumps designed for use in applications including mass spec calibration, drug and nutritional studies, reactor dosing, and electro-spinning
Supplier:  AMBEED, INC
Description:   2-Ethyl-3-hydroxy-4H-pyran-4-one, Purity: 98%, CAS Number: 4940-11-8, Appearance: Form: Crystal - Powder/Colour: White - Almost white, Storage: Sealed in dry, Room Temperature, Size: 100g
Catalog Number: (103007-598)

Supplier:  Anaspec Inc
Description:   This is amino acids 11 to 42 fragment of beta-amyloid. This peptide was detected in Alzheimer disease brains within several principal beta-amyloid variants.
Sequence: EVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 3335.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Catalog Number: (102835-292)

Supplier:  Matrix Scientific
Description:   3-(2,4-Dinitrophenoxy)benzaldehyde ≥97%
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
2,897 - 2,912  of 18,386