Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

Triisopropanolamine


2  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"2"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  AMBEED, INC
Description:   2,5-Dioxopyrrolidin-1-yl 2-(((tert-butoxycarbonyl)amino)oxy)acetate, Purity: 98%, CAS Number: 80366-85-4, Appearance: White to almost white powder to crystal, Storage: Keep in dark place, Inert atmosphere, Store in freezer, under -20 C, Size: 1g
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 041757-1G , MDL Number: MFCD00076973

Supplier:  Enzo Life Sciences
Description:   Produced in E. coli. A non-glycoylated protein containnig 53 amino acids.
Supplier:  AGILENT TECHNOLOGIES, INC (CSD)
Description:   Designed for the separation of optically active compounds, especially amino acids.
Catalog Number: (10062-472)

Supplier:  Prosci
Description:   19 amino acid peptide near the carboxy terminus of human APO-E.
Supplier:  TCI America
Description:   [Good's buffer component for biological research]
CAS Number: 68399-81-5
MDL Number: MFCD00038352
Molecular Formula: C7H17NO7S
Molecular Weight: 259.27
Purity/Analysis Method: >99.0% (T)
Form: Crystal
Color: White
MSDS SDS
Supplier:  ALADDIN SCIENTIFIC
Description:   2-Aminoterephthalic acid can be used to synthesize:· Lanthanide coordination polymers with 1,10-phenanthroline by hydrothermal method.· Blue-emitting derivatives of 2-aminoterephthalic acid.· Amino-functionalized Zr-terephthalate (UiO-66), an excellent catalyst for selective synthesis of jasminaldehyde.· IRMOF-3, a zinc aminoterephthalate metal-organic framework useful as a catalyst for the Knoevenagel condensation of benzaldehyde and ethyl cyanoacetate.· Polymeric composite membrane with excellent CO2 separation capabilities.
New Product
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 041958-1G , MDL Number: MFCD01863049
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 041332-1G , MDL Number: MFCD00211287
Supplier:  TCI America
Description:   CAS Number: 54446-36-5
MDL Number: MFCD07779504
Molecular Formula: C12H10BrN
Molecular Weight: 248.12
Purity/Analysis Method: >98.0% (GC)
Form: Crystal
Boiling point (°C): 318
Melting point (°C): 87
MSDS SDS
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 041328-250MG , MDL Number: MFCD04112694
Supplier:  AOB CHEM USA
Description:   tert-Butyl-N-[4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)phenyl]carbamate ≥95%
Catalog Number: (103006-440)

Supplier:  Anaspec Inc
Description:   This peptide is from amino acid 3-42 of the full length 42-amino acid long GIP (Glucose-dependent Insulinotropic Polypeptide or also known as Gastric Inhibitory Polypeptide). The in-vivo degradation of the first two N-terminal amino acids (Tyr-Ala) by the enzyme dipeptidyl peptidase IV (DPP IV) results in making GIP (3-42) a potent antagonist as opposed to the agonist full length GIP on the GIP receptor.
Sequence: EGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
MW: 4759.4 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Supplier:  AMBEED, INC
Description:   N-[(S)-1-Ethoxycarbonyl-3-phenylpropyl]-L-alanine 97%

Supplier:  LGC STANDARDS
Description:   2-Amino-5-methylpyridine, TRC, LGC Standards
New Product
Supplier:  MilliporeSigma
Description:   L-3,3'',5-Triiodothyronine, Free Acid, High Purity. (T3). Beige solid. PROTECT FROM LIGHT. Chromatographically purified. Purity: >= 99% by HPLC. Soluble in 100 mM NaOH. RTECS AY6750000, CAS 6893-02-3, M.W. 651.0.
MSDS SDS
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
3,265 - 2  of 2
  1  2  3  4  5  6  7  8  9  10  11  12  13  14  15  Next