Print…
You Searched For:
2 results were found
2,6-Bis(bromomethyl)naphthalene
Catalog Number:
(103007-440)
Supplier:
Anaspec Inc
Description:
This is 22 amino acids flagellin peptide known as flg2. It spans the core domain necessary for binding and biological activity in plant cells. This peptide spanning the 22 amino acids in the core of the conserved domain induces responses after treatment with fungal elicitors such as chitin fragments, xylanase, ergosterol, and high-mannose–type glycopeptides when applied in subnanomolar concentrations. Flagellin is the structural protein that forms the major portion of flagellar filaments. Flagellins from different bacterial species vary in their central part but show conservation of their N-terminal and C-terminal regions.
Sequence:QRLSTGSRINSAKDDAAGLQIA MW:2272.5 Da % peak area by HPLC:95 Storage condition:-20° C
Supplier:
REVACC INC
Description:
A recombinant form of the receptor binding domain (RBD with amino acids 319 to 541) of the spike (S) glycoprotein gene from severe acute respiratory syndrome-related coronavirus 2 (SARS-CoV-2), Wuhan-Hu-1 (GenBank: MN908947) was produced by human embryonic kidney HEK293F cells, followed by purification.
Supplier:
AAT BIOQUEST INC
Description:
The FMK peptides are potent, cell permeable, irreversible capase inhibitors.
Catalog Number:
(ALA163252-1G)
Supplier:
ALADDIN SCIENTIFIC
Description:
Amino functionalized polyethylene glycol (NH2-PEG-NH2) is a homobifunctional PEG derivative that can be used to modify proteins, peptides and other materials via carboxylic group (-COOH) or other amine reactive chemical groups. PEGylation can increase solubility and stability and reduce immunogenicity of peptides and proteins. It can also suppress the non-specific binding of charged molecules to the modified surfaces.
Supplier:
Sino Biological
Description:
A DNA sequence encoding the amino acid (Met 1-Ala 189) of human SCF (P21583-1) extracellular domain was expressed, with a polyhistidine tag at the C-terminus.
Supplier:
Thermo Scientific Chemicals
Description:
EDTA tripotassium salt dihydrate. Grade:99, Melting Point ca 182*[degree]C. Boiling Point C:NA. C10H13K3N2O8. 2H2O. 65501-24-8.
Catalog Number:
(103005-970)
Supplier:
Anaspec Inc
Description:
A 36-amino acid Cl- channel blocker from Leiurus quinquestriatus scorpion venom.
Sequence:MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR-NH2 (Disulfide bridge: 2-19,5-28,16-33,20-35) MW:3996 Da % peak area by HPLC:95 Storage condition:-20° C
Catalog Number:
(101803-986)
Supplier:
Matrix Scientific
Description:
Matrix Scientific Part Number: 016058-500MG , MDL Number: MFCD04039876
Catalog Number:
(10450-490)
Supplier:
Bioss
Description:
Catalyzes the first reaction in the catabolism of the essential branched chain amino acids leucine, isoleucine, and valine. May also function as a transporter of branched chain alpha-keto acids.
Supplier:
AMBEED, INC
Description:
Z-Cha-OH 95%
Catalog Number:
(103679-706)
Supplier:
Sino Biological
Description:
The mature form of human CARPX (NP_001076002.1) (Met 1-Asn 300) with five amino acids (DDDDK) at the C-terminus was expressed and purified.
Catalog Number:
(10451-966)
Supplier:
Bioss
Description:
Required for the function of light chain amino-acid transporters. Involved in sodium-independent, high-affinity transport of large neutral amino acids such as phenylalanine, tyrosine, leucine, arginine and tryptophan. Involved in guiding and targeting of LAT1 and LAT2 to the plasma membrane. When associated with SLC7A6 or SLC7A7 acts as an arginine/glutamine exchanger, following an antiport mechanism for amino acid transport, influencing arginine release in exchange for extracellular amino acids. Plays a role in nitric oxide synthesis in human umbilical vein endothelial cells (HUVECs) via transport of L-arginine. Required for normal and neoplastic cell growth. When associated with SLC7A5/LAT1, is also involved in the transport of L-DOPA across the blood-brain barrier, and that of thyroid hormones triiodothyronine (T3) and thyroxine (T4) across the cell membrane in tissues such as placenta. Involved in the uptake of methylmercury (MeHg) when administered as the L-cysteine or D,L-homocysteine complexes, and hence plays a role in metal ion homeostasis and toxicity. When associated with SLC7A5 or SLC7A8, involved in the cellular activity of small molecular weight nitrosothiols, via the stereoselective transport of L-nitrosocysteine (L-CNSO) across the transmembrane. Together with ICAM1, regulates the transport activity LAT2 in polarized intestinal cells, by generating and delivering intracellular signals. When associated with SLC7A5, plays an important role in transporting L-leucine from the circulating blood to the retina across the inner blood-retinal barrier.
Catalog Number:
(10451-964)
Supplier:
Bioss
Description:
Required for the function of light chain amino-acid transporters. Involved in sodium-independent, high-affinity transport of large neutral amino acids such as phenylalanine, tyrosine, leucine, arginine and tryptophan. Involved in guiding and targeting of LAT1 and LAT2 to the plasma membrane. When associated with SLC7A6 or SLC7A7 acts as an arginine/glutamine exchanger, following an antiport mechanism for amino acid transport, influencing arginine release in exchange for extracellular amino acids. Plays a role in nitric oxide synthesis in human umbilical vein endothelial cells (HUVECs) via transport of L-arginine. Required for normal and neoplastic cell growth. When associated with SLC7A5/LAT1, is also involved in the transport of L-DOPA across the blood-brain barrier, and that of thyroid hormones triiodothyronine (T3) and thyroxine (T4) across the cell membrane in tissues such as placenta. Involved in the uptake of methylmercury (MeHg) when administered as the L-cysteine or D,L-homocysteine complexes, and hence plays a role in metal ion homeostasis and toxicity. When associated with SLC7A5 or SLC7A8, involved in the cellular activity of small molecular weight nitrosothiols, via the stereoselective transport of L-nitrosocysteine (L-CNSO) across the transmembrane. Together with ICAM1, regulates the transport activity LAT2 in polarized intestinal cells, by generating and delivering intracellular signals. When associated with SLC7A5, plays an important role in transporting L-leucine from the circulating blood to the retina across the inner blood-retinal barrier.
Supplier:
MilliporeSigma
Description:
Glycine crystal, Suitable for use as excipient EMPROVE* exp Ph.Eur,BP,JP,USP, Cas No. 56-40-6, Molecular Formula: H2NCH2COOH, Synonyms: Gly, Aminoacetic acid, Aminoethanoic acid, Size: 5kg
Catalog Number:
(103007-132)
Supplier:
Anaspec Inc
Description:
This synthetic peptide corresponds to amino acids 20 to 42 of b-Amyloid protein.
Sequence: FAEDVGSNKGAIIGLMVGGVVIA Molecular Weight: 2217.6 Da % Peak Area by HPLC: ≥95 Peptide Content: ≥ 60% Storage condition: -20°C
Catalog Number:
(102996-508)
Supplier:
Anaspec Inc
Description:
Conantokin G (Con G) toxin is a 17-amino-acid competitive antagonist of N-methyl-D-aspartate (NMDA) receptors. It was isolated from the venom of Conus geographus and it belongs to a unique family of g-carboxyglutamic acid-containing Conus peptides.
Sequence:GE(Gla)(Gla)LQ(Gla)NQ(Gla)LIR(Gla)KSN-NH2 MW:2264.2 Da % peak area by HPLC:95 Storage condition:-20° C
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
 is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
|
|||||||||
List View
