1-(4-Chlorophenyl)cyclopentanecarboxylic+acid
Supplier:
Bachem Americas
Description:
Reverse sequence of Aβ 25-35 (H-1192), inactive control.
Supplier:
Bachem Americas
Description:
Antimicrobial peptides are produced by plants and most organisms throughout the animal kingdom including humans. Antimicrobial peptides protect against a broad range of infectious agents, as bacteria, fungi, and viruses. The amphibian skin is an especially rich source of antimicrobial peptides. See also the product families: Hepcidins LL-37 and Fragments Tuftsin and Analogs (subfamily).
Catalog Number:
(G-1775.0001BA)
Supplier:
Bachem Americas
Description:
Also known as dioxopiperazines, piperazine-2,5-diones or DKPs. Diketopiperazines may occur as by-products during peptide synthesis or during the degradation of peptides. These cyclic dipeptides have been detected as taste-modulating compounds in food, they often show biological activity. DKPs are valuable chiral synthons, employed e.g. in Schöllkopf's versatile bislactim ether approach. They also have found use as catalysts for enantioselective synthesis, e.g. in the asymmetric Strecker reaction. See also the TRH metabolite cyclo(-His-Pro), G-1745, and cyclo(-Asp-Phe), G-1695, the major degradation product of aspartame.
Supplier:
Bachem Americas
Description:
Triarginine.
Catalog Number:
(A-2200.0025BA)
Supplier:
Bachem Americas
Description:
Sequence: Boc-Phe-Leu-Phe-Leu-Phe-OH
Synonym(s): Boc-FLFLF#Boc-2
Supplier:
Bachem Americas
Description:
Exendin (9-39) is a potent glucagon-like peptide 1 (GLP-1) receptor antagonist. It has also been described as an antagonist of the putative exendin receptor. Exendin (9-39) blocks the stimulatory action of GLP-1 (7- 36) amide (H- 6795) and of exendin-4 (H- 8730) on cAMP production in pancreatic acini. Moreover, exendin (9-39) was shown to be safely used to abolish the incretin effect of GLP-1 without interfering with the control of insulin secretion by circulating nutrients.
Catalog Number:
(G-3345.0001BA)
Supplier:
Bachem Americas
Description:
1G CAS: 13123-35-8 C17H23N3O3 FW: 317.39
Supplier:
Bachem Americas
Description:
HG-13, LEEEEEAYGWMDF-amide, has been isolated from tumor tissue. The peptide corresponds to the fragment 5-17 of human gastrin I.
Supplier:
Bachem Americas
Description:
1G CAS: 107856-82-6 C9H15N3O4 FW: 229.24
Supplier:
PeproTech, Inc.
Description:
Recombinant Human Il-17D (Animal free), is a 40.5 kDa disulfide-linked homodimer of two 185 amino acid polypeptide chains, Purity: Greater than 98% by SDS-PAGE gel and HPLC analyses, Source: E.coli, Cross Reactivity: Mouse, Synonyms: Interleukin-17D, Size: 1MG
Supplier:
Bachem Americas
Description:
1mg CAS: 144409-98-3 C190H291N51O57S FW: 4233.78 . amyloid
Supplier:
Bachem Americas
Description:
This fluorescent (FRET) peptide substrate contains the wild-type amyloid precursor protein (APP) β-secretase cleavage site. Mca-SEVKMDAEFRK(Dnp)RR- amide has been used for assaying β-secretase-like activity of thimet oligopeptidase (TOP, EC 3.4.24.15). The results suggested that TOP is a potential β-secretase candidate and is involved in the processing of APP in vivo. See also L-1905.
Supplier:
Bachem Americas
Description:
(Tyr³⁶)-pTHrP (1-36) has been used for radioiodination.
Supplier:
Bachem Americas
Description:
CRF (corticotropin-releasing factor) is a 41-peptide produced mainly in the hypothalamus. The peptide hormone stimulates ACTH release from the anterior lobe of the pituitary gland. CRF plays an important role in the endocrine, behavioral, and immune response to stress and probably as well in the regulation of energy balance. The human sequence EEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII amide also corresponds to the sequence of canine, feline, murine, and porcine CRF.
Supplier:
Bachem Americas
Description:
0.5mg (Disulfide bonds between Cys7 and Cys23/Cys10 and Cys13/Cys11 and Cys19/Cys14 and Cys22) C123H184N36O33S10 FW: 3015.7 . Synonym: Biotinyl-Hepc25 (human), Biotinyl-LEAP-1 (human), Biotinyl-Liver-Expressed Antimicrobial Peptide (human), Biotinyl-PLTR (human), Biotinyl-Putative Liver Tumor Regressor (human)
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
![]()
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
![]()
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
|
|||||||||