Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results

You Searched For:

Proteins and Peptides


29,649  results were found
Proteins and Peptides

Proteins are used in routine laboratory procedures such as binding enzymes or coupling peptides to carrier proteins. These kits, mixture solutions, and collagen matrices fulfill a myriad of essential laboratory functions for developing relationships between proteins and other cellular components. The stimulating proteins offered have various amino acid arrangements and functions to fulfill any sample manipulation for testing purposes in any field.


SearchPresentationType-HORIZONTAL
Choose from the options below to refine your search. Click OK to update your results.
 
 
SearchResultCount:"29649"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  ANTIBODIES.COM LLC
Description:   Recombinant Human Furin (from HEK293 cells)
Catalog Number: (77561-092)

Supplier:  Sino Biological
Description:   The 39 amino acids of PDKtide peptide sequence ([protein fragment, 39 aa]) is derived from two human proteins: residues 1-14 are based on AKT1 (307-320) and residues 16-39 are based on PKN2/PRK2 (961-984).
New Product
Supplier:  ANTIBODIES.COM LLC
Description:   Recombinant Human BCMA (from HEK293 cells)

Supplier:  AAT BIOQUEST INC
Description:   Chloramphenicol-BSA conjugate is used for developing anti-chloramphenicol antibodies that are typically used in an ELISA assay.
Small Business Enterprise Minority or Woman-Owned Business Enterprise

Supplier:  ANTIBODIES.COM LLC
Description:   Recombinant Human ICOS (from HEK293 cells)

Supplier:  ANTIBODIES.COM LLC
Description:   Synthetic Human STEAP2 (from HEK293 cells)
Catalog Number: (AAJ63275-LB0)

Supplier:  Thermo Scientific Chemicals
Description:   CAS No.: 9076-44-2
Molecular Formula: C31H41N7O6
Formula Weight: 604.90
Physical Form: Powder
Appearance: White to off-white
Melting Point: 276-278°
MDL No.: MFCD00071059
MSDS SDS
Supplier:  ANTIBODIES.COM LLC
Description:   Recombinant Human GPCR GPRC5D (from HEK293 cells)
Catalog Number: (10062-672)

Supplier:  Prosci
Description:   16 amino acids near the center of human FOXA2.
Catalog Number: (10814-316)

Supplier:  Thermo Scientific Chemicals
Description:   CAS No.: 9000-71-9
Physical Form: Powder
Appearance: Off-white to pale yellow
Odor: Odorless
MDL No.: MFCD00081481
Catalog Number: (AAJ66728-MCR)

Supplier:  Thermo Scientific Chemicals
Description:   8] Vasopressin
Catalog Number: (AAJ66599-MCR)

Supplier:  Thermo Scientific Chemicals
Description:   Allatostatin III
Catalog Number: (77558-088)

Supplier:  Sino Biological
Description:   The Histone H4 Peptide (1-21) sequence (SGRGKGGKGL-GKGGAKRHRKVGGKKC) is derived from human histone H4 (1-21) and is suitable for use as the substrate for histone methyltransferase (at R3) and acetyltransferase (at K5, K8, K12 and K16) family assays.
New Product
Catalog Number: (AAJ64583-MCR)

Supplier:  Thermo Scientific Chemicals
Description:   CAS No.: 154674-81-4
Molecular Formula: C33H42N4O10
Formula Weight: 654.71
Storage Temperature: -30°C to -10°C
Physical Form: Powder
Appearance: White
Solubility: Soluble in DMSO
MDL No.: MFCD00798794
MSDS SDS
Catalog Number: (AAJ60591-LB0)

Supplier:  Thermo Scientific Chemicals
Description:   Synthetic peptide substrate for protein kinase A.
MSDS SDS
Catalog Number: (76485-454)

Supplier:  AAT BIOQUEST INC
Description:   Coronaviruses (CoVs) can infect humans and multiple species of animals, causing a wide spectrum of diseases.
Small Business Enterprise Minority or Woman-Owned Business Enterprise
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
8,993 - 9,008  of 29,649