(±)-2,2-Difluoro-1-methylcyclopropanecarboxylic+acid
Catalog Number:
(101841-558)
Supplier:
Matrix Scientific
Description:
Matrix Scientific Part Number: 036529-500MG , MDL Number: MFCD06805599
Catalog Number:
(RL603-106-007)
Supplier:
Rockland Immunochemical
Description:
This product has been assayed against 1.0 µg of Chicken IgM in a standard capture ELISA using Peroxidase Conjugated Streptavidin and ABTS (2,2’-azino-bis-[3-ethylbenthiazoline-6-sulfonic acid])
Catalog Number:
(75790-194)
Supplier:
Prosci
Description:
Syndecan-1 is a single-pass type I membrane protein that belongs to the syndecan proteoglycan family. The syndecans mediate cell binding, cell signaling, and cytoskeletal organization and syndecan receptors are required for internalization of the HIV-1 tat protein. Human SDC1 is synthesized as a 310 amino acid precursor that contains a 22 amino acid signal sequence, and a 288 amino acid mature chain. The Syndecan-1 protein functions as an integral membrane protein and participates in cell proliferation, cell migration and cell-matrix interactions via its receptor for extracellular matrix proteins. Altered Syndecan-1 expression has been detected in several different tumor types.
Catalog Number:
(75928-880)
Supplier:
Rockland Immunochemical
Description:
Interleukin-22 (IL-22) is a cytokine important for the modulation of tissue responses during inflammation (1). Unlike the distantly related IL-10, IL-22 does not inhibit the production of proinflammatory cytokines in monocytes in response to LPS, but it has some inhibitory effects on IL-4 production from Th2 T cells. IL-22 is expressed by both the adaptive arm of the immune system such as CD4 T cell subsets including Th17 cells, as well as by innate lymphocytes such as NK and LTi-like cells (2). IL-22 is highly expressed in several chronic inflammatory conditions, and studies suggest that IL-22 plays both inflammatory and protective roles (3).
Catalog Number:
(103007-114)
Supplier:
Anaspec Inc
Description:
This is amino acids 1 to 40 fragment of the mutant form of beta-amyloid, with glycine substituted for glutamic acid at position 22 found in “Arctic” heredity. A toxic soluble beta-amyloid assembly (TA-beta) is formed more rapidly from 'Arctic' beta-amyloid than from wild-type beta-amyloid in the presence of liposomes containing GM1 ganglioside.
Sequence: DAEFRHDSGYEVHHQKLVFFAGDVGSNKGAIIGLMVGGVVIA MW: 4442.1 Da % Peak Area by HPLC: ≥95 Peptide Content: ≥ 60% Storage condition: -20°C
Catalog Number:
(10206-638)
Supplier:
Boster Biological Technology
Description:
Rabbit IgG polyclonal antibody for Solute carrier family 22 member 6(SLC22A6) detection. Tested with WB, IHC-P in Human;Rat.
Supplier:
MP Biomedicals
Description:
Protein purification reagent Triethanolamine acts as an organic additive in the grinding of cement clinker and as a complexing agent for aluminum ions in aqueous solutions.
It is used as an emulsifier and a surfactant. It finds application in common products like dishwashing liquids, general cleaners, hand cleaners, shaving cream, metalworking fluids, liquid laundry detergents, paints and printing inks. It is used for the neutralization of fatty acids and adjusting buffer pH as well as utilized to dissolve oils. It acts as an effective complexing agent in electroless plating. Further, it is used in hair care products like hair dyes and wave sets.
Catalog Number:
(10670-236)
Supplier:
Bioss
Description:
The RING-type zinc finger motif is present in a number of viral and eukaryotic proteins and is made of a conserved cysteine-rich domain that is able to bind two zinc atoms. Proteins that contain this conserved domain are generally involved in the ubiquitination pathway of protein degradation. RNF185 (ring finger protein 185), also known as FLJ38628, is a 192 amino acid multi-pass membrane protein containing one RING-type zinc finger. Two RNF185 isoforms exist as a result of alternative splicing, and the gene encoding RNF185 maps to human chromosome 22, which houses over 500 genes and is the second smallest human chromosome. Mutations in several of the genes that map to chromosome 22 are involved in the development of Phelan-McDermid syndrome, Neurofibromatosis type 2, autism and schizophrenia.
Catalog Number:
(TCE0089-025G)
Supplier:
TCI America
Description:
CAS Number: 15137-09-4
MDL Number: MFCD00054448 Molecular Formula: C10H16N2O8 Molecular Weight: 393.12 Purity/Analysis Method: >98.0% (T) Form: Crystal
Catalog Number:
(10110-722)
Supplier:
Prosci
Description:
ACTR1B is a 42.3 kD subunit of dynactin, a macromolecular complex consisting of 10 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein and is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. ACTR1B, like ACTR1A, is an actin-related protein. These two proteins, which are of equal length and share 90% amino acid identity, are present in a constant ratio of approximately 1:15 in the dynactin complex.This gene encodes a 42.3 kD subunit of dynactin, a macromolecular complex consisting of 10 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein. It is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. This subunit, like ACTR1A, is an actin-related protein. These two proteins are of equal length and share 90% amino acid identity. They are present in a constant ratio of approximately 1:15 in the dynactin complex.
Supplier:
Biotium
Description:
Indo-1, AM ester is membrane-permeant and thus can be loaded into cells via incubation. Because of the relatively low water solubility of the AM ester, Pluronic F-127, a mild detergent, is often used as a dispersing agent to facilitate cell loading. Indo-1-AM Ester itself does not bind Ca2+ , but it is readily hydrolyzed to indo-1 by endogenous esterases once it enters cells.
Supplier:
TCI America
Description:
CAS Number: 3105-95-1
MDL Number: MFCD00005981 Molecular Formula: C6H11NO2 Molecular Weight: 129.16 Purity/Analysis Method: >97.0% (T) Form: Crystal Color: White Specific rotation [a]20/D: -27 deg (C=4, H2O)
Catalog Number:
(10072-844)
Supplier:
Prosci
Description:
IL-19 belongs to the IL-10 family of regulatory cytokines which includes IL-10, IL-19, IL-20, IL-22, IL-24 and IL-26. Members of this family share partial homology in their amino acid sequences but they are dissimilar in their biological functions. Preliminary data suggests that IL-19 is a proinflammatory cytokine because it up-regulates IL-6 and TNF-α and induces apoptosis through TNF-α. IL-19 signals through the type I IL-20R. Human and murine IL-19 share 71% amino acid sequence identity. Recombinant human IL-19 is a 17.9 kDa protein containing 153 amino acid residues. In solution IL-19 exists predominantly as a non-disulfide-linked dimer.
Supplier:
DWK Life Sciences (KIMBLE)
Description:
These caps are designed for use with WHEATON® glass bottles or vials.
![]()
Catalog Number:
(75791-062)
Supplier:
Prosci
Description:
Hepcidin(HAMP)is a secreted protein that belongs to the hepcidin family.It is expressed in liver, heart and brain. It is involved in the maintenance of iron homeostasis, and it is necessary for the regulation of iron storage in macrophages, and for intestinal iron absorption. The preproprotein is post-translationally cleaved into mature peptides of 20, 22 and 25 amino acids, and these active peptides are rich in cysteines, which form intramolecular bonds that stabilize their beta sheet structures.
Catalog Number:
(RL610-4604)
Supplier:
Rockland Immunochemical
Description:
This product has been assayed against 1.0 µg of Mouse IgG in a standard capture ELISA using Peroxidase Conjugated Streptavidin and ABTS (2,2’-azino-bis-[3-ethylbenthiazoline-6-sulfonic acid])
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
![]()
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
![]()
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
|
|||||||||