Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

(2,2\\\\\\\'-Bipyridine)bis(1,10-phenanthroline)ruthenium(2+)+bis


31,985  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"31985"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  LGC STANDARDS
Description:   N,N-Bis(2-chloroethyl)benzenesulfonamide, TRC, LGC Standards
New Product
Supplier:  BeanTown Chemical
Description:   CAS: 7440-69-9; EC No: 231-177-4; MDL No: MFCD00134033; RTECS: EB2600000 Solid; Molecular Formula: Bi; MW: 208.98 Melting Point: 271°; Boiling Point: 1560° Density (g/mL): 9.8
MSDS SDS

Supplier:  AFG BIOSCIENCE LLC
Description:   Human Interleukin-22 (IL-22) ELISA Kit, AFG Bioscience
Catalog Number: (BT137245-100MG)

Supplier:  BeanTown Chemical
Description:   CAS: 478308-93-9; MDL No: MFCD08064216 Powder; Molecular Formula: C60H66Cl2N4O4P2Ru; MW: 1141.11 Air Sensitive
MSDS SDS
Supplier:  AMBEED, INC
Description:   1-((3aR,6S,7aS)-8,8-Dimethyl-2,2-dioxidohexahydro-1H-3a,6-methanobenzo[c]isothiazol-1-yl)propan-1-one, Purity: 98%, CAS number: 128947-19-3, Appearance: Solid, Storage: Sealed in dry, Room Temperature, Size: 1G
Supplier:  Thermo Scientific Chemicals
Description:   Physical Form: Liquid
MDL No.: MFCD00134033
MSDS SDS
Supplier:  LGC STANDARDS
Description:   1,1'-[(1-Methylethyl)imino]bis[3-(naphthalen-1-yloxy)propan-2-ol] Hydrochloride (Tertiary Amine Derivative Hydrochloride), Mikromol, LGC Standards
New Product
Supplier:  Thermo Scientific Chemicals
Description:   IDT-2BR, 5,5'-[[4,4,9,9-Tetrakis(4-hexylphenyl)-4,9-dihydro-s-indaceno[1,2-b:5,6-b']dithiophene-2,7-diyl]bis(2,1,3-benzothiadiazole-7,4-diylmethylidyne)]bis[3-ethyl-2-thioxo-4-thiazolidinone], Formula: C88H88N6O2S8, Formula Weight: 1518.20, Storage & Sensitivity: Ambient temperatures, Size: 250mg
Supplier:  AMBEED, INC
Description:   (2R,3R,4R,5S)-6-(Methylamino)hexane-1,2,3,4,5-pentaol ((3-(((2R,3S)-2-((R)-1-(3,5-bis(trifluoromethyl)phenyl)ethoxy)-3-(4-fluorophenyl)morpholino)methyl)-5-oxo-4,5-dihydro-1H-1,2,4-triazol-1-yl)phosphonate)(2:1) 98%
Supplier:  AMBEED, INC
Description:   (4S,4'S)-1,1'-Di([1,1'-biphenyl]-4-yl)-4,4'-diisopropyl-4,4',5,5'-tetrahydro-1H,1'H-2,2'-biimidazole ≥97%
New Product
Supplier:  Polymedco
Description:   Sed-Chek 2 is a whole blood reference control material designed to monitor ESR procedures.
Catalog Number: (103003-156)

Supplier:  Anaspec Inc
Description:   AM (22-52) is known as an adrenomedullin receptor antagonist and a cardiac depressant factor, although there is some discrepancy in the literature regarding the selectivity of ADM 22-52 as adrenomedullin receptor antagonist.
Sequence:TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2
MW:3576 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Supplier:  MP Biomedicals
Description:   For convenience and safety, MP is pleased to offer premixed acrylamide and methylene-bis-acrylamide. Avoid handling of toxic powders, tedious weighings, and concern over spillage and waste. Each bottle contains our Ultra Pure Acrylamide and Ultra Pure N,N′-Methylene-bis-acrylamide in a choice of two sizes and three different ratios.
MSDS SDS
Supplier:  LGC STANDARDS
Description:   Butanedioic Acid 1,4-Bis(2,5-dioxo-3-sulfo-1-pyrrolidinyl) Ester Disodium Salt (Technical Grade), TRC, LGC Standards
New Product
Supplier:  Thermo Scientific Chemicals
Description:   PBDB-T (PCE12), Poly[(2,6-(4,8-bis(5-(2-ethylhexyl)thiophen-2-yl)-benzo[1,2-b:4,5-b]dithiophene))-alt-(5,5-(1,3-di-2-thienyl-5,7-bis(2-ethylhexyl)benzo[1,2-c:4,5-c]dithiophene-4,8-dione)], Formula: (C68H78O2S8)n, Storage and Sensitivity: Ambient temperatures, Size: 500mg

Supplier:  MP Biomedicals
Description:   These premixes are a premix of ultra pure acrylamide with the cross-linking reagent N,N'-methylene-bis-acrylamide. MP offers these premixes with the final ratios of 19:1, 29:1 or 37.5:1.
MSDS SDS
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
8,017 - 8,032  of 31,985