Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

(2,2-Difluorobenzo[d][1,3]dioxol-5-yl)methanamine


75,271  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"75271"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  TCI America
Description:   CAS Number: 126-84-1
MDL Number: MFCD00009224
Molecular Formula: C7H16O2
Molecular Weight: 132.20
Purity/Analysis Method: >95.0% (GC)
Form: Clear Liquid
Boiling point (°C): 113
Flash Point (°C): 7
Specific Gravity (20/20): 0.83
Storage Temperature: 0-10°C
MSDS SDS
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 047223-500MG , MDL Number: MFCD09027101
Supplier:  Strem Chemicals Inc
Description:   min. 98% 1g
Supplier:  AMBEED, INC
Description:   (S)-3,3'-Bis(3,5-diphenyl)phenyl-1,1'-binaphthyl-2,2'-diyl Hydrogen Phosphate, Purity: 98% 99%ee, CAS Number: 1496637-05-8, Appearance: White to yellow powder or crystals, Storage: Inert atmosphere, 2-8 C, Size: 1g
Supplier:  AMBEED, INC
Description:   2,2',2''-(1,3,5-Triazinane-1,3,5-triyl)triethanol ≥75%
Supplier:  TCI America
Description:   CAS Number: 41484-35-9 MDL Number: MFCD00059346 Molecular Formula: C38H58O6S Molecular Weight: 642.94 Purity/Analysis Method: <gt/>98.0% (HPLC,T) Form: Crystal Color: White Melting point (°C): 78
MSDS SDS
Supplier:  AMBEED, INC
Description:   (4S,4'S)-4,4'-Diisopropyl-1,1'-di-p-tolyl-4,4',5,5'-tetrahydro-1H,1'H-2,2'-biimidazole ≥97%
New Product
Supplier:  Strem Chemicals Inc
Description:   CAS #: 13813-22-4. Size: 5g.
Supplier:  Strem Chemicals Inc
Description:   BIPHEP, Phosphine
Supplier:  AMBEED, INC
Description:   Diethyl dipropylmalonate 97%
Supplier:  Matrix Scientific
Description:   MF=C4H4F3N3S MW=183.16 Cas=25366-22-7 MDL=MFCD00042321 ,1G
Supplier:  AMBEED, INC
Description:   (4S,4'S)-2,2'-((Phenylphosphanediyl)bis(2,1-phenylene))bis(4-(tert-butyl)-4,5-dihydrooxazole), Purity: 97%, CAS Number: 642491-11-0, Appearance: White to Yellow Powder or crystals, Storage: Keep in dark place, Inert atmosphere, 2-8C, Size: 250MG
Supplier:  AMBEED, INC
Description:   (3aS,3a'S,8aR,8a'R)-2,2'-(Cyclopropane-1,1-diyl)bis(8,8a-dihydro-3aH-indeno[1,2-d]oxazole), Purity: 98% 99%ee, CAS number: 182122-08-3, Appearance: White to yellow powder or crystals, Storage: Inert atmosphere, 2-8C, Size: 1G
Catalog Number: (103003-156)

Supplier:  Anaspec Inc
Description:   AM (22-52) is known as an adrenomedullin receptor antagonist and a cardiac depressant factor, although there is some discrepancy in the literature regarding the selectivity of ADM 22-52 as adrenomedullin receptor antagonist.
Sequence:TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2
MW:3576 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Supplier:  AMBEED, INC
Description:   2,2'-Thiodisuccinic acid, Purity: 98%, CAS Number: 4917-76-4, Appearance: White to light-yellow solid, Storage: Sealed in dry, Room Temperature, Size: 25g
Supplier:  AMBEED, INC
Description:   (1R)-3,3'-Di-9-anthracenyl-5,5',6,6',7,7',8,8'-octahydro-[1,1'-binaphthalene]-2,2'-diol, Purity: 98%, CAS Number: 1011465-21-6, Appearance: Solid, Storage: Inert atmosphere, 2-8 C, Size: 5g
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
7,889 - 7,904  of 75,271