Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

(2,2-Difluorobenzo[d][1,3]dioxol-5-yl)methanamine


75,503  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"75503"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  PeproTech, Inc.
Description:   PeproTech's Murine IL-22 ELISA development kit contains the key components required for the quantitative measurement of natural and/or recombinant murine IL-22 in a sandwich ELISA format.
Catalog Number: (103003-156)

Supplier:  Anaspec Inc
Description:   AM (22-52) is known as an adrenomedullin receptor antagonist and a cardiac depressant factor, although there is some discrepancy in the literature regarding the selectivity of ADM 22-52 as adrenomedullin receptor antagonist.
Sequence:TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2
MW:3576 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Supplier:  AMBEED, INC
Description:   (2S,2'S)-2,2'-(1,3,6,8-Tetraoxo-1,3,6,8-tetrahydrobenzo[lmn][3,8]phenanthroline-2,7-diyl)dipropionic acid, Purity: 97%, CAS Number: 429692-85-3, Appearance: Solid, Storage: Sealed in dry, Room Temperature, Size: 1G
Supplier:  Matrix Scientific
Description:   MF=C8H11CLN2OS MW=218.71 CAS=199851-22-4 MDL=MFCD03453082 5G
Supplier:  Matrix Scientific
Description:   MF=C12H21Bf2O5 MW=294.11 Cas=1272412-65-3 ,1G
Supplier:  TCI America
Description:   Clinofibrate, CAS Number: 30299-08-2, Purity: 98.0%, Molecular Formula: C28H36O6, Molecular Weight: 468.59 g/mol, Synonyms: 2,2'-(4,4'-Cyclohexylidenediphenoxy)-2,2'-dimethyldibutanoic Acid, Physical Form: Solid, Size: 200MG
MSDS SDS
Catalog Number: (220025-286)

Supplier:  R&D Systems
Description:   The Recombinant Mouse IL-22 Protein from R&D Systems is derived from E. coli. The Recombinant Mouse IL-22 Protein has been validated for the following applications: Bioactivity.
Supplier:  PeproTech, Inc.
Description:   PeproTech's Human IL-22 ELISA development kit contains the key components required for the quantitative measurement of natural and/or recombinant human IL-22 in a sandwich ELISA format.
Supplier:  VWR International
Description:   Ideal for general transfer applications.
CE certificate
Catalog Number: (TCA0582-025G)

Supplier:  TCI America
Description:   [for Calcium determination]
CAS Number: 1836-22-2
MDL Number: MFCD00046379
Molecular Formula: C17H12N2O9S2
Molecular Weight: 518.35
Form: Crystal
Color: Yellow Red
MSDS SDS
Supplier:  AMBEED, INC
Description:   (S)-4,4'-Bis(bis(3,5-dimethylphenyl)phosphino)-2,2',6,6'-tetramethoxy-3,3'-bipyridine, Purity: 98%, CAS number: 443347-10-2, Appearance: Form: solid, Storage: Inert atmosphere, Room Temperature, Size: 100MG

Supplier:  Eagle Biosciences
Description:   Human IL-22 ELISA detects human IL-22 concentrations in cell culture supernates, serum, and plasma.
Supplier:  Novus Biologicals
Description:   The FGF-22 Antibody (MM0286-4F28) from Novus Biologicals is a mouse monoclonal antibody to FGF-22. This antibody reacts with human. The FGF-22 Antibody (MM0286-4F28) has been validated for the following applications: Western Blot, Blocking / Neutralizing.
Supplier:  Strem Chemicals Inc
Description:   CAS #: 1522-22-1. Size: 25g.
Catalog Number: (102513-886)

Supplier:  Adipogen
Description:   Interleukin-22 (IL-22), also known as IL-10 related T cell derived inducible factor (ILTIF) was initially identified as a gene induced by IL-9 in mouse T cells and mast cells. IL-22 has been shown to activate STAT1 and STAT3 in several hepatoma cell lines and upregulate the production of acute phase proteins. IL-22 is produced by normal T cells upon anti-CD3 stimulation in humans. Mouse IL-22 expression is also induced in various organs upon lipopolysaccharide injection, suggesting that IL-22 may be involved in inflammatory responses. The functional IL-22 receptor complex consists of two receptor subunits, IL-22R(CRF29) and IL-10Rbeta(CRF24), belonging to the class II cytokine receptor family.
Small Business Enterprise
Supplier:  TCI America
Description:   Cesium Pivalate, Purity: >97.0%(T), CAS Number: 20442-70-0, Molecular Formula: C5H9CsO2, Molecular Weight: 234.03, Synonyms: Cesium 2,2-Dimethylpropionate, Size: 5G
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
7,921 - 7,936  of 75,503