4-Iodo-7H-pyrrolo[2,3-d]pyrimidine
Catalog Number:
(10667-190)
Supplier:
Bioss
Description:
Members of the suppressor of cytokine signaling (SOCS) family of proteins contain C-terminal regions of homology called the SOCS box, which serves to couple SOCS proteins and their binding partners with the Elongin B/C complex. Several other families of proteins also contain SOCS boxes, but differ from the SOCS proteins in the type of domain they contain upstream of the SOCS box. The largest family of SOCS box-containing proteins is the ankyrin repeat and SOCS box-containing (ASB) protein family. ASB-13 (ankyrin repeat and SOCS box-containing 13) is a 278 amino acid member of the ASB family that contains one SOCS box domain and six ANK repeats. Existing as multiple isoforms, ASB-13 functions as a substrate-recognition component of an E3 ubiquitin-protein ligase complex and, working in conjunction with other proteins, plays a role in the ubiquitination and subsequent proteasomal degradation of target proteins.
Catalog Number:
(10667-212)
Supplier:
Bioss
Description:
Members of the suppressor of cytokine signaling (SOCS) family of proteins contain C-terminal regions of homology called the SOCS box, which serves to couple SOCS proteins and their binding partners with the Elongin B/C complex. Several other families of proteins also contain SOCS boxes, but differ from the SOCS proteins in the type of domain they contain upstream of the SOCS box. The largest family of SOCS box-containing proteins is the ankyrin repeat and SOCS box-containing (ASB) protein family. ASB-13 (ankyrin repeat and SOCS box-containing 13) is a 278 amino acid member of the ASB family that contains one SOCS box domain and six ANK repeats. Existing as multiple isoforms, ASB-13 functions as a substrate-recognition component of an E3 ubiquitin-protein ligase complex and, working in conjunction with other proteins, plays a role in the ubiquitination and subsequent proteasomal degradation of target proteins.
Catalog Number:
(10665-980)
Supplier:
Bioss
Description:
PDZK4, also known as PDZRN4L (PDZ domain-containing RING finger protein 4-like protein) or LU1, is a 769 amino acid coiled-coil protein that contains one PDZ (DHR) domain. Encoded by a gene that maps to human chromosome Xq28, PDZK4 is conserved in dog, cow, mouse, rat and zebrafish. PDZK4 localizes to cytoplasm and is expressed specifically in adult and fetal brain. PDZK4 functions as an oncogene and is up-regulated in synovial carcinomas. Treatment of synovial sarcoma cells with small interfering RNA (siRNA) inhibits PDZK4 expression, resulting in tumor-cell growth suppression, suggesting that inappropriate expression of PDZK4 may play a role synovial sarcoma cell proliferation.The exact function of FRMPD2 is unknown. The protein contains a FERM domain: such structures are often involved in signal transduction pathways. Alternatively spliced transcript variants encoding different isoforms have been identified.
Catalog Number:
(10667-204)
Supplier:
Bioss
Description:
Members of the suppressor of cytokine signaling (SOCS) family of proteins contain C-terminal regions of homology called the SOCS box, which serves to couple SOCS proteins and their binding partners with the Elongin B/C complex. Several other families of proteins also contain SOCS boxes, but differ from the SOCS proteins in the type of domain they contain upstream of the SOCS box. The largest family of SOCS box-containing proteins is the ankyrin repeat and SOCS box-containing (ASB) protein family. ASB-13 (ankyrin repeat and SOCS box-containing 13) is a 278 amino acid member of the ASB family that contains one SOCS box domain and six ANK repeats. Existing as multiple isoforms, ASB-13 functions as a substrate-recognition component of an E3 ubiquitin-protein ligase complex and, working in conjunction with other proteins, plays a role in the ubiquitination and subsequent proteasomal degradation of target proteins.
Catalog Number:
(10667-206)
Supplier:
Bioss
Description:
Members of the suppressor of cytokine signaling (SOCS) family of proteins contain C-terminal regions of homology called the SOCS box, which serves to couple SOCS proteins and their binding partners with the Elongin B/C complex. Several other families of proteins also contain SOCS boxes, but differ from the SOCS proteins in the type of domain they contain upstream of the SOCS box. The largest family of SOCS box-containing proteins is the ankyrin repeat and SOCS box-containing (ASB) protein family. ASB-13 (ankyrin repeat and SOCS box-containing 13) is a 278 amino acid member of the ASB family that contains one SOCS box domain and six ANK repeats. Existing as multiple isoforms, ASB-13 functions as a substrate-recognition component of an E3 ubiquitin-protein ligase complex and, working in conjunction with other proteins, plays a role in the ubiquitination and subsequent proteasomal degradation of target proteins.
Catalog Number:
(10668-488)
Supplier:
Bioss
Description:
The RING-type zinc finger motif is present in a number of viral and eukaryotic proteins and is made of a conserved cysteine-rich domain that is able to bind two zinc atoms. Proteins that contain this conserved domain are generally involved in the ubiquitination pathway of protein degradation. RNF10 (ring finger protein 10), also known as RIE2, is an 811 amino acid protein that localizes to the cytoplasm and contains one RING-type zinc finger. Existing as multiple alternatively spliced isoforms, RNF10 interacts with MOX-2 and is thought to regulate its transcription in schwann cells, possibly playing a role in myelin formation. The gene encoding RNF10 maps to human chromosome 12, which encodes over 1,100 genes and comprises approximately 4.5% of the human genome. Chromosome 12 is associated with a variety of diseases and afflictions, including hypochondrogenesis, achondrogenesis, Kniest dysplasia, Noonan syndrome and Trisomy 12p, which causes facial developmental defects and seizure disorders.
Catalog Number:
(76121-006)
Supplier:
Bioss
Description:
CPN2 is a zinc metalloprotease, and cleaves carboxy-terminal arginines and lysines from peptides found in the bloodstream such as complement anaphylatoxins, kinins, and creatine kinase MM (CK-MM). By removing only one amino acid, CPN has the ability to change peptide activity and receptor binding. It is a 280 kDa tetrameric glycoprotein that is synthesized by the liver and secreted into the plasma. It consists of 2 identical 83 kDa regulatory subunits (CPN2) and 2 identical 50 kDa catalytic subunits (CPN1). CPN2, the 83 kDa subunit, binds and stabilizes the catalytic subunit at 37 degrees Celsius and keeps it in circulation. Under some circumstances it may be an allosteric modifier of the catalytic subunit. CPN is a member of a larger family of carboxypeptidases, many of which also cleave arginine and lysine. Because of the highly conserved active sites and the possible redundant functions of carboxypeptidases, it has been difficult to elucidate the role of CPN in disease processes.
Catalog Number:
(76109-762)
Supplier:
Bioss
Description:
PDZK4, also known as PDZRN4L (PDZ domain-containing RING finger protein 4-like protein) or LU1, is a 769 amino acid coiled-coil protein that contains one PDZ (DHR) domain. Encoded by a gene that maps to human chromosome Xq28, PDZK4 is conserved in dog, cow, mouse, rat and zebrafish. PDZK4 localizes to cytoplasm and is expressed specifically in adult and fetal brain. PDZK4 functions as an oncogene and is up-regulated in synovial carcinomas. Treatment of synovial sarcoma cells with small interfering RNA (siRNA) inhibits PDZK4 expression, resulting in tumor-cell growth suppression, suggesting that inappropriate expression of PDZK4 may play a role synovial sarcoma cell proliferation.The exact function of FRMPD2 is unknown. The protein contains a FERM domain: such structures are often involved in signal transduction pathways. Alternatively spliced transcript variants encoding different isoforms have been identified.
Catalog Number:
(76110-346)
Supplier:
Bioss
Description:
The deduced 257 amino acid protein PACRG (Parkin co-regulated gene) shows potential links to the ubiquitin/proteasome system. PACRG and Parkin are attached in a head-to-head arrangement on opposite DNA strands and share a common 5' flanking promoter region. The PACRG gene maps to chromosome 6q26; Northern blot analysis detects PACRG expression in all tissues examined except placenta. Using a positional cloning strategy in 197 Vietnamese leprosy simplex families (i.e. families with two unaffected parents and one affected child), significant connections between leprosy and 17 markers in the 5' regulatory region that PARK2 and PACRG share were observed. Possession of two or more of the 17 risk alleles is highly predictive of leprosy.PACRG is a gene located very close to parkin, in reverse orientation on the chromosome. It is thought to be co-transcribed with parkin by a bi-directional promoter between the two genes.
Catalog Number:
(76110-018)
Supplier:
Bioss
Description:
Members of the suppressor of cytokine signaling (SOCS) family of proteins contain C-terminal regions of homology called the SOCS box, which serves to couple SOCS proteins and their binding partners with the Elongin B/C complex. Several other families of proteins also contain SOCS boxes, but differ from the SOCS proteins in the type of domain they contain upstream of the SOCS box. The largest family of SOCS box-containing proteins is the ankyrin repeat and SOCS box-containing (ASB) protein family. ASB-7 (ankyrin repeat and SOCS box-containing 7) is a 318 amino acid protein that contains one SOCS box domain and seven ANK repeats and belongs to the ASB family. Existing as multiple alternatively spliced isoforms, ASB-7 functions as a substrate-recognition component of an E3 ubiquitin-protein ligase complex and, working in conjunction with other proteins, plays a role in the ubiquitination and subsequent proteasomal degradation of target proteins.
Catalog Number:
(10480-226)
Supplier:
Bioss
Description:
DCAKD belongs to the coaE family. It contains one DPCK (dephospho CoA kinase) domain. There are two isoforms.Coenzyme A (CoA) is an essential cofactor used in numerous biochemical pathways. It plays a critical role in the synthesis and oxidation of fatty acids and is vital to the citric acid cycle. The biosynthesis pathway of CoA from pantothenic acid (also known as vitamin B5) is essential and universal in prokaryotes and eukaryotes. In humans, the final steps of the biosynthesis pathway are carried out by the bifunctional enzyme COASY. The sequence of these enzymes are highly conserved between different bacterial species. The phosphopantetheine adenylyltransferase and decoenzyme A kinase activities of COASY are evolutionarily conserved activities. DCAKD (deCoA kinase domain containing protein) is a 231 amino acid protein that consists of a deCoA kinase domain and an ATP nucleotide binding motif. Localizing to mitochondria and the cytosol, DCAKD belongs to the coaE family which suggests that it may play a role in the biosynthesis of CoA.
Catalog Number:
(103006-368)
Supplier:
Anaspec Inc
Description:
BNP-45 represents the 45 amino acids at the C-terminus and the mouse BNP-45 has all the amino acid residues thought essential for NP bioactivity, although sequence identity when studied with other BNP hormones (rat, 64%; dog, 53%; pig, 50%; and human, 44%) was clearly less than the identity among ANF hormones. The threonine 81 residue at which a protein kinase C phosphorylation site is present in the putative mature mouse BNP-45 hormone is not conserved in the rat sequence.
Sequence:SQDSAFRIQERLRNSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (Disulfide bridge:23 - 39) MW:5040.8 Da %Peak area by HPLC:≥95% Storage condition: -20°C
Catalog Number:
(76011-498)
Supplier:
Prosci
Description:
Voltage-dependent calcium channels are composed of five subunits. The protein encoded by this gene represents one of these subunits, gamma, and is one of two known gamma subunit proteins. This particular gamma subunit is an integral membrane protein that is thought to stabilize the calcium channel in an inactive (closed) state. This gene is part of a functionally diverse eight-member protein subfamily of the PMP-22/EMP/MP20 family and is located in a cluster with two family members that function as transmembrane AMPA receptor regulatory proteins (TARPs). Alternative splicing results in multiple transcript variants. Variants in this gene have been associated with aspirin-intolerant asthma.
Catalog Number:
(10304-612)
Supplier:
Bioss
Description:
Protocadherins are a large family of cadherin-like cell adhesion proteins that are involved in the establishment and maintenance of neuronal connections in the brain. There are three protocadherin gene clusters, designated alpha, beta and gamma, all of which contain multiple tandemly arranged genes. PCDHB1 (Protocadherin beta 1) is an 818 amino acid protein that is one of 16 proteins in the protocadherin beta cluster. Unlike the alpha and gamma gene clusters whose genes are spliced to downstream constant region exons during transcription, members of the beta cluster (such as PCDHB1) do not use constant-region exons to produce mRNAs. As a result, each protocadherin beta gene encodes the transmembrane, extracellular and short cytoplasmic domains of the protein. PCDHB1 is a single-pass type I membrane protein containing six cadherin domains.
Catalog Number:
(10304-632)
Supplier:
Bioss
Description:
Protocadherins are a large family of cadherin-like cell adhesion proteins that are involved in the establishment and maintenance of neuronal connections in the brain. There are three protocadherin gene clusters, designated a, b and g, all of which contain multiple tandemly-arranged genes. PCDHB10 (protocadherin b10), also known as PCHB10 or PCDH-b10, is an 800 amino acid protein that is one of 16 proteins in the protocadherin b cluster. Unlike the a and g gene clusters, whose genes are spliced to downstream constant-region exons during transcription, members of the b cluster (such as PCDHB10) do not use constant-region exons to produce mRNAs. As a result, each protocadherin b gene encodes the transmembrane, extracellular and short cytoplasmic domains of the protein. Localized to the cell membrane, PCDHB10 is a single-pass type I membrane protein that contains six cadherin domains.
Catalog Number:
(10304-670)
Supplier:
Bioss
Description:
Protocadherins are a large family of cadherin-like cell adhesion proteins that are involved in the establishment and maintenance of neuronal connections in the brain. There are three protocadherin gene clusters, designated alpha, beta and gamma, all of which contain multiple tandemly arranged genes. PCDHB14 (Protocadherin beta 14) is a 798 amino acid protein that is one of 16 proteins in the protocadherin beta cluster. Unlike the alpha and gamma gene clusters whos genes are spliced to downstream constant region exons during transcription, members of the beta cluster (such as PCDHB14) do not use constant-region exons to produce mRNAs. As a result, each protocadherin beta gene encodes the transmembrane, extracellular and short cytoplasmic domains of the protein. Localized to the cell membrane, PCDHB14 is a single-pass type I membrane protein that contains six cadherin domains.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
![]()
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
![]()
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
|
|||||||||