Text Search >
(2R,2\\\'R)-4,4\\\'-Disulfanediylbis(2-aminobutanoic+acid)
Print…
You Searched For:
137,824 results were found
(2R,2\\\'R)-4,4\\\'-Disulfanediylbis(2-aminobutanoic+acid)
Catalog Number:
(IC0210116625)
Supplier:
MP Biomedicals
Description:
β-NADP is a coenzyme necessary for the alcoholic fermentation of glucose and the oxidative dehydrogenation of other substances. It occurs widely in living tissue, especially in the liver. Nicotinic acid can be converted to nicotinamide in the body and, in this form, is found as a component of two oxidation-reduction coenzymes: nicotinamide adenine dinucleotide (NAD) and nicotinamide adenine dinucleotide phosphate (NADP). The nicotinamide portion of the coenzyme transfers hydrogens by alternating between oxidized quaternary nitrogen and a reduced tertiary nitrogen. NADP is an essential coenzyme for glucose-6-phosphate dehydrogenase which catalyzes the oxidation of glucose-6-phosphate to 6-phosphogluconic acid. This reaction initiates metabolism of glucose by a pathway other than the citric acid cycle. This route is known as the hexose phosphate shunt or phosphogluconate pathway. Other enzymes which utilize NADP as a coenzyme are: Alcohol dehydrogenase:NADP dependent; Aromatic ADH:NADP dependent; Ferredoxin-NADP reductase; L-Fucose dehydrogenase; Gabase; Galactose-1-phosphate uridyl transferase; Glucose dehydrogenase; L-Glutamic dehydrogenase; Glycerol dehydrogenase:NADP specific; Isocitric dehydrogenase; Malic enzymes; 5,10-Methylenetetrahydrofolate dehydrogenase; 6-Phosphogluconate dehydrogenase and Succinic semialdehyde dehydrogenase.
Catalog Number:
(101879-518)
Supplier:
Matrix Scientific
Description:
Matrix Scientific Part Number: 047327-500MG , MDL Number: MFCD09817453
Supplier:
Thermo Scientific Chemicals
Description:
Biological stain, dye reagent, acid base indicator: pH 0.0 yellow, 2.0 green;11.6 green, 14 colorless
Supplier:
AMBEED, INC
Description:
2,4-Dioxo-1,2,3,4-tetrahydropyrimidine-5-carboxylic acid, Purity: 97%, CAS Number: 59299-01-3, Appearance: Solid, Storage: Sealed in dry, 2-8C, Size: 5G
Catalog Number:
(RK31008)
Supplier:
Restek
Description:
Contains: Benzoic acid (65-85-0); 4-Chloro-3-methylphenol (59-50-7); 2-Chlorophenol (95-57-8); 2,4-Dichlorophenol (120-83-2); 2,4-Dimethylphenol (105-67-9); 4,6-Dinitro-2-methylphenol (Dinitro-o-cresol) (534-52-1); 2,4-Dinitrophenol (51-28-5); 2-Methylphenol (o-cresol) (95-48-7); 4-Methylphenol (p-cresol) (106-44-5); 2-Nitrophenol (88-75-5); 4-Nitrophenol (100-02-7); Pentachlorophenol (87-86-5); Phenol (108-95-2); 2,4,5-Trichlorophenol (95-95-4); 2,4,6-Trichlorophenol (88-06-2).
Supplier:
Biotium
Description:
CD6 is a type I transmembrane glycoprotein that contains a 24-amino acid signal sequence, three extracellular scavenger receptor cysteine-rich (SRCR) domains, a membrane-spanning domain and a 44-amino acid cytoplasmic domain. The CD6 glycoprotein is tyrosine phosphorylated during TCR-mediated T cell activation. CD6 shows significant homology to CD5. CD6 is present on mature thymocytes, peripheral T cells and a subset of B cells. Antibodies to CD6 are used to deplete T cells from bone marrow transplants to prevent graft versus host disease.
CF® dyes are Biotium's next-generation fluorescent dyes. CF®568 is a red fluorescent dye (Ex/Em 562/583 nm) with superior brightness and photostability. It also is compatible with super-resolution imaging by STORM and TIRF.
Catalog Number:
(103824-990)
Supplier:
Sino Biological
Description:
A DNA sequence encoding the human coronavirus (HCoV-OC43) hemagglutinin esterase protein (APU51943.1) (Leu17-Pro394) was expressed with a polyhistidine tag at the C-terminus.
Supplier:
MP Biomedicals
Description:
Ammonium tartrate, the ammonium salt of tartaric acid, is used in such applications as cell culture and chromatography.
Catalog Number:
(101928-878)
Supplier:
Matrix Scientific
Description:
Matrix Scientific Part Number: 065039-500MG , MDL Number: MFCD03851865
Catalog Number:
(103664-830)
Supplier:
Sino Biological
Description:
A DNA sequence encoding the mouse CLEC4N (NP_064385.1) extracellular domain (Ile 44-Leu 209) was expressed, with a C-terminal polyhistidine tag.
Supplier:
AMBEED, INC
Description:
H-D-2-Pal-OH, Purity: 98%, CAS Number: 37535-52-7, Appearance: Solid, Storage: Keep in dark place, Inert atmosphere, Room temperature, Size: 5g
Catalog Number:
(103006-368)
Supplier:
Anaspec Inc
Description:
BNP-45 represents the 45 amino acids at the C-terminus and the mouse BNP-45 has all the amino acid residues thought essential for NP bioactivity, although sequence identity when studied with other BNP hormones (rat, 64%; dog, 53%; pig, 50%; and human, 44%) was clearly less than the identity among ANF hormones. The threonine 81 residue at which a protein kinase C phosphorylation site is present in the putative mature mouse BNP-45 hormone is not conserved in the rat sequence.
Sequence:SQDSAFRIQERLRNSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (Disulfide bridge:23 - 39) MW:5040.8 Da %Peak area by HPLC:≥95% Storage condition: -20°C
Supplier:
Spectrum Chemicals
Description:
Aluminum Acetate, Dibasic, Stabilized with Boric Acid, Powder is a salt that is used as a topical astringent to treat skin irritations from poison ivy, substances such as soaps and cosmetics and insect bites. Aluminum acetate is particularly helpful for foot problems including athlete’s foot, swelling, and excessive sweating. It is also used to treat ear canal infections. Ungraded products supplied by Spectrum are indicative of a grade suitable for general industrial use or research purposes and typically are not suitable for human consumption or therapeutic use. These materials may or may not have a Certificate of Analysis available
Catalog Number:
(77669-234)
Supplier:
AMBEED, INC
Description:
Fmoc-Phe(CF2PO3)-OH 96%
Catalog Number:
(101921-230)
Supplier:
Matrix Scientific
Description:
Matrix Scientific Part Number: 061065-500MG , MDL Number:
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
 is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
|
|||||||||
List View
