Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results

You Searched For:

1-(2,5-Difluoro-4-hydroxyphenyl)ethanone


30,529  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"30529"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  Eagle Biosciences
Description:   Anti-Beta 2 GP-I Screen ELISA determines IgG,IgM and IgA Ab (screening) to Beta2 glycoprotein-I.
Catalog Number: (103231-068)

Supplier:  Novus Biologicals
Description:   GUSB, Polyclonal Antibody, Host: Sheep, Species reactivity: Human, Isotype: IgG, Immunogen: Mouse myeloma cell line NS0-derived recombinant human beta -Glucuronidase/GUSB, Synonyms: beta-Glucuronidase, beta-D-glucuronidase, Beta-G1, Application: WB, Size: 100ug
Catalog Number: (76732-602)

Supplier:  ANTIBODIES.COM LLC
Description:   Mouse beta Crosslaps/beta CTx ELISA kit is a competitive Enzyme-Linked Immunosorbent Assay (cELISA) designed for the <i>in vitro</i> quantitative determination of mouse beta Crosslaps/beta CTx in serum, plasma, tissue homogenates, and other biological fluids.
Catalog Number: (76739-562)

Supplier:  ANTIBODIES.COM LLC
Description:   Human beta Crosslaps/beta CTx ELISA kit is a competitive Enzyme-Linked Immunosorbent Assay (cELISA) designed for the <i>in vitro</i> quantitative determination of human beta Crosslaps/beta CTx in serum, plasma, tissue homogenates, and other biological fluids.

Supplier:  Novus Biologicals
Description:   The beta-III Tubulin Antibody from Novus Biologicals is a chicken polyclonal antibody to beta-III Tubulin. This antibody reacts with human, mouse, rat. The beta-III Tubulin Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry / Immunofluorescence, Immunohistochemistry Whole-Mount.

Supplier:  Novus Biologicals
Description:   The IkB-beta Antibody (3B5) from Novus Biologicals is a mouse monoclonal antibody to IkB-beta. This antibody reacts with human. The IkB-beta Antibody (3B5) has been validated for the following applications: Western Blot, ELISA.
Catalog Number: (103009-022)

Supplier:  Anaspec Inc
Description:   This peptide is beta-amyloid (1-42) with substitution of Phe19 to Pro. This substitution inhibits amyloid fibril formation, which is implicated in neurodegenerative diseases such as Alzheimer’s.
Sequence: DAEFRHDSGYEVHHQKLVFFAENVGSNKGAIIGLMVGGVVIA
MW: 4513.1 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 041820-1G , MDL Number: MFCD00800585

Supplier:  Bioss
Description:   The cerebral and vascular plaques associated with Alzheimer's disease are mainly composed of Amyloid beta peptides. beta Amyloid is derived from cleavage of the Amyloid precursor protein and varies in length from 39 to 43 amino acids. beta Amyloid [1-40], beta Amyloid [1-42], and beta Amyloid [1-43] peptides result from cleavage of Amyloid precursor protein after residues 40, 42, and 43, respectively. The cleavage takes place by gamma-secretase during the last Amyloid precursor protein processing step. beta Amyloid [1-40], beta Amyloid [1-42], and beta Amyloid [1-43] peptides are major constituents of the plaques and tangles that occur in Alzheimer's disease. beta Amyloid and peptides have been developed as tools for elucidating the biology of Alzheimer's disease.

Supplier:  Boster Biological Technology
Description:   Mouse IgG monoclonal antibody for beta-HCG, chorionic gonadotropin, beta polypeptide (CGB) detection. Tested with IHC-P in Human. No cross reactivity with other proteins.
Supplier:  Novus Biologicals
Description:   The beta 2-Microglobulin Antibody (246-E9.E7 (same as HLA.ABC.m2)) [DyLight 550] from Novus Biologicals is a mouse monoclonal antibody to beta 2-Microglobulin. This antibody reacts with human, primate (negative). The beta 2-Microglobulin Antibody (246-E9.E7 (same as HLA.ABC.m2)) [DyLight 550] has been validated for the following applications: Flow Cytometry.
Supplier:  Thermo Scientific Chemicals
Description:   2-Nitro-1-(3-nitrophenyl)ethene 3-Nitro-beta-nitrostyrene. Grade:98, Melting Point C125-127*. Boiling Point C:NA. C8H6N2O4. 882-26-8. IRRITANT
MSDS SDS
Supplier:  Boster Biological Technology
Description:   Sandwich High Sensitivity ELISA kit for Quantitative Detection of activated Dog Caninea TGF-beta 2
Supplier:  Novus Biologicals
Description:   The IKK beta Antibody (10A9B6) [HRP] from Novus Biologicals is a mouse monoclonal antibody to IKK beta. This antibody reacts with human, mouse. The IKK beta Antibody (10A9B6) [HRP] has been validated for the following applications: Western Blot.
Catalog Number: (89282-520)

Supplier:  Genetex
Description:   Rabbit polyclonal antibody to beta 2 Defensin
Catalog Number: (76740-324)

Supplier:  ANTIBODIES.COM LLC
Description:   Rat Dopamine beta Hydroxylase ELISA kit is a sandwich Enzyme-Linked Immunosorbent Assay (sELISA) designed for the <i>in vitro</i> quantitative determination of rat Dopamine beta Hydroxylase in serum, plasma, tissue homogenates, and other biological fluids.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
161 - 176  of 30,529