Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results

You Searched For:

4-Bromo-2-fluorophenyl+isothiocyanate


18,941  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"18941"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Catalog Number: (103259-010)

Supplier:  Novus Biologicals
Description:   The ECH1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to ECH1. This antibody reacts with human. The ECH1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Catalog Number: (103389-376)

Supplier:  Eagle Biosciences
Description:   VEGF ELISA detects human Vascular Endothelial Growth Factor concentrations in biological samples.
Supplier:  LIFE TECHNOLOGIES CORP
Description:   Biosate Peptone is an animal origin (AO) mixed hydrolysate comprised of 65% pancreatic digest of casein and 35% yeast extract. This combination provides synergistic nutritional benefits that are not provided by the components alone, resulting in a unique nutritional profile.
Supplier:  Dickies
Description:   Dickies® style JTC2.
Catalog Number: (RL200-401-890)

Supplier:  Rockland Immunochemical
Description:   This Protein A purified antibody has been tested for use in ELISA, western blot, immunohisto-chemistry,  immunoprecipitation and immunofluorescence.   Specific conditions for reactivity should be optimized by the end user. Expect a band ~ 25 kDa to 35 kD.
Supplier:  SIEMENS
Description:   RAPIDLab® 1200 Blood Gas Analyzers from Siemens Healthcare Diagnostics help expedite clinical decision making by generating immediate, trusted results for critical analytes. The same RAPIDLab® 1200 Series Blood Gas Analyzer has been proven to address the need for accurate process analytics in all stages of development of bioprocessing applications.
Supplier:  Anaspec Inc
Description:   All the HCl salt forms of Aß (1-40), Aß (25-35) and D-Ser26 Aß (25-35), take the ß-structure within a few hours in PBS. They form fibrils, exert toxic effects on hippocampal cultured neurons and suppress MTT reduction activity of non-neuronal (HeLa) cells without cytotoxicity.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV ? HCl
Molecular Weight: 4329.9+36.5 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Supplier:  PERKINELMER U.S. LLC
Description:   Standard rectangular macro and micro cells are the most frequently used type of spectroscopy cell for routine liquids analysis.

Supplier:  Eagle Biosciences
Description:   Mouse GIP (Active) ELISA determines mouse GIP (1-42) active form in plasma and culture medium.
Supplier:  Restek
Description:   Use of these liners helps ensure an inert GC flow path for higher sensitivity, accuracy, and reproducibility.
Catalog Number: (103329-442)

Supplier:  Novus Biologicals
Description:   The IFI35 Antibody from Novus Biologicals is a rabbit polyclonal antibody to IFI35. This antibody reacts with human, mouse. The IFI35 Antibody has been validated for the following applications: Western Blot, Immunocytochemistry / Immunofluorescence.
Supplier:  Dickies
Description:   Dickies® style 48274.
Catalog Number: (10164-442)

Supplier:  Genetex
Description:   Rabbit polyclonal antibody to CD8
Supplier:  Tonbo Biosciences
Description:   The 53-6.7 antibody reacts with the 32-34 kDa alpha subunit of mouse CD8, known as CD8a or CD8 alpha. CD8a can form a homodimer (CD8 alpha-alpha), but is more commonly expressed as a heterodimer with a second chain known as CD8b or CD8 beta. CD8 acts as a co-receptor in antigen recognition and subsequent T cell activation that is initiated upon binding of the T cell receptor (TCR) to antigen-bearing MHC Class I molecules. The cytoplasmic domains of CD8 provide binding sites for the tyrosine kinase lck, facilitating intracellular signaling events that lead to T cell activation, development, and cytotoxic effector functions. CD8+ cytotoxic T cells (CTLs) play an important role in inducing cell death of tumor cells, as well as cells infected by virus, bacteria or parasites.
Supplier:  BIOPTECHS INC.
Description:   Double Tube Pump Sets are available in a variety of inner diameter thicknesses with manifold ends to fit the Bioptechs Micro-Perfusion Pumps.
Catalog Number: (470219-534)

Supplier:  Wards
Description:   The rolling friction car kit provides four cars for exploration into the force of friction. Each car provides a set of different material wheels (wood, fabric, soft rubber, soft silicone) with a different coefficient of friction. By setting the cars in motion with equivalent velocities, one can qualitatively demonstrate the frictional properties of rolling without slipping.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
10,481 - 10,496  of 18,941