Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results

You Searched For:

L-Asparaginamide+hydrochloride


18,944  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"18944"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 058230-5G , MDL Number: MFCD00052595
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 052223-500MG , MDL Number: MFCD13561996
Supplier:  Anaspec Inc
Description:   All the HCl salt forms of Aß (1-40), Aß (25-35) and D-Ser26 Aß (25-35), take the ß-structure within a few hours in PBS. They form fibrils, exert toxic effects on hippocampal cultured neurons and suppress MTT reduction activity of non-neuronal (HeLa) cells without cytotoxicity.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV ? HCl
Molecular Weight: 4329.9+36.5 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Supplier:  Genetex
Description:   Hamster Monoclonal antibody to BCL-3

Supplier:  Matrix Scientific
MSDS SDS
Supplier:  AOB CHEM USA
Description:   2,4-Difluoro-6-iodoaniline ≥97%
Supplier:  Dickies
Description:   Dickies® style LP537.
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 044883-500MG , MDL Number: MFCD00454124
Supplier:  Electron Microscopy Sciences
Description:   The Howard cell is a glass slide 76 x 35 mm with a central circular island and is used for counting mold fibers and spores in fruit juices, especially from tomatoes.
Minority or Woman-Owned Business Enterprise
Catalog Number: (77614-488)

Supplier:  AMBEED, INC
Description:   2,4-Difluoro-6-iodoaniline ≥95%
New Product
Supplier:  Ace Glass
Description:   This graduated, round bottom receiving flask is a replacement for receivers on all glassware sets supplied with Heidolph LR4000 Series rotary evaporators or with other evaporators
Small Business Enterprise Product available on GSA Advantage®
Supplier:  TCI America
Description:   CAS Number: 104706-47-0
MDL Number: MFCD00191570
Molecular Formula: C4H9NO
Molecular Weight: 123.58
Purity/Analysis Method: >98.0% (T)
Form: Crystal
Color: White
Melting point (°C): 109
Specific rotation [a]20/D: -7.8 deg (C=3.5, MeOH)
MSDS SDS
Supplier:  Matrix Scientific
MSDS SDS
Supplier:  AMBEED, INC
Description:   Paromomycin sulfate ≥97%
New Product
Catalog Number: (AAJ66901-03)

Supplier:  Thermo Scientific Chemicals
Description:   Powder
MSDS SDS

Supplier:  Roboz Surgical
Description:   Metzenbaum (Lahey) Scissors; Straight; Blade Length 35 mm; 7" Overall Length
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
9,841 - 9,856  of 18,944