Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

Sodium+chloride+hydroxylamine+sulfate+solution


163,958  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"163958"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  PeproTech, Inc.
Description:   CTACK is a keratinocyte-derived CC chemokine which signals through the CCR10 receptor. Both CTACK and CCR10 are expressed in normal and irritated epithelial cells. CTACK selectively attracts CLA+ T-cells and directs them into the skin. CTACK contains the four highly conserved cysteine residues present in most CC chemokines. The mature protein contains 88 amino acid residues. Recombinant Murine CTACK (CCL27) is a 10.9 kDa protein containing 95 amino acid residues.
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 021442-500MG , MDL Number: MFCD07788853
Supplier:  TCI America
Description:   CAS Number: 207121-46-8
MDL Number: MFCD00150051
Molecular Formula: C3H7NO2S
Molecular Weight: 157.61
Purity/Analysis Method: >99.0% (T)
Form: Crystal
Specific rotation [a]20/D: -6 deg (C=8, 1mol/L HCl)
MSDS SDS
Catalog Number: (10082-280)

Supplier:  Proteintech
Description:   APH, (APEH, acylpeptide hydrolase), which catalyzes the hydrolysis of the terminal acetylated amino acid preferentially from small acetylated peptides. The acylpeptide hydrolase is a homotetrameric protein of 300 kDa with each subunit consisting of 732 amino acid residues. A range of molecular masses have been reported for APH by previous investigators, including 80 kD, 75 kD and 69 kD. This antibody can recognize at least 2 isoforms of APH.
Supplier:  AMBEED, INC
Description:   5-Aminobenzene-1,2,3-tricarboxylic acid, Purity: 96%, CAS Number: 37141-01-8, Appearance: Pale-yellow to Yellow-brown Solid, Storage: Keep in dark place, Inert atmosphere, Room temperature, Size: 1g
Supplier:  Enzo Life Sciences
Description:   Produced in <i>E. coli.</i> A non-glycosylated protein containing 74 amino acids.
Supplier:  PeproTech, Inc.
Description:   SDF-1α and β are stromal-derived, CXC chemokines that signal through the CXCR4 receptor. SDF-1α and β chemoattract B and T cells, and have been shown to induce migration of CD34+ stem cells. Additionally, the SDF-1 proteins exert HIV-suppressive activity in cells expressing the CXCR4 receptor. Human and murine SDF-1 proteins act across species. SDF-1α and β contain the four highly conserved cysteine residues present in CXC chemokines. The mature SDF-1β protein, produced by an N-terminal truncation of two additional amino acids, after removal of the signal sequence, contains 72 amino acid residues. Recombinant Human SDF-1β (CXCL12) is an 8.5 kDa protein containing 72 amino acid residues.
Supplier:  AAT BIOQUEST INC
Description:   5(6)-TRITC is an amino-reactive labeling reagent that is widely used in preparing bioconjugates of proteins and nucleic acids.
Small Business Enterprise Minority or Woman-Owned Business Enterprise
Supplier:  AMBEED, INC
Description:   Z-L-Aspartic acid α-tert-butyl ester dicyclohexylammonium salt 98%
Supplier:  Bachem Americas
Description:   Sequence: Z-Glu-OMe
Catalog Number: (103006-440)

Supplier:  Anaspec Inc
Description:   This peptide is from amino acid 3-42 of the full length 42-amino acid long GIP (Glucose-dependent Insulinotropic Polypeptide or also known as Gastric Inhibitory Polypeptide). The in-vivo degradation of the first two N-terminal amino acids (Tyr-Ala) by the enzyme dipeptidyl peptidase IV (DPP IV) results in making GIP (3-42) a potent antagonist as opposed to the agonist full length GIP on the GIP receptor.
Sequence: EGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
MW: 4759.4 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Catalog Number: (F-2135.0005BA)

Supplier:  Bachem Americas
Description:   Sequence: H-m-Fluoro-DL-Phe-OH
Catalog Number: (103011-166)

Supplier:  Anaspec Inc
Description:   Emission-ratiometric fluorescent indicator for quantifying intracellular Ca2+ concentration.
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 041479-25G , MDL Number: MFCD01320855
Supplier:  TCI America
Description:   CAS Number: 99-31-0
MDL Number: MFCD00002522
Molecular Formula: C8H7NO4
Molecular Weight: 181.15
Purity/Analysis Method: >98.0% (T)
Form: Crystal
MSDS SDS
Supplier:  Bachem Americas
Description:   Sequence: Fmoc-γ-Abu-OH
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
3,841 - 3,856  of 163,958