Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results

You Searched For:

3\\\'-Iodoacetophenone


33,994  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"33994"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  TCI America
Description:   CAS Number: 128446-36-6 MDL Number: MFCD00074980 Form: Crystal Color: White Flash Point (°C): 187
MSDS SDS

Supplier:  Prosci
Description:   Human DNA polymerase beta is constitutively expressed in cells

Supplier:  Novus Biologicals
Description:   The Guanylyl Cyclase beta 1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Guanylyl Cyclase beta 1. This antibody reacts with human. The Guanylyl Cyclase beta 1 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Supplier:  Novus Biologicals
Description:   The beta-III Tubulin Antibody (TU-20) [Allophycocyanin] from Novus Biologicals is a mouse monoclonal antibody to beta-III Tubulin. This antibody reacts with human, mouse, all species. The beta-III Tubulin Antibody (TU-20) [Allophycocyanin] has been validated for the following applications: Flow Cytometry.
Catalog Number: (77514-124)

Supplier:  AFG BIOSCIENCE LLC
Description:   Mouse IFNb (Interferon Beta) ELISA Kit
Supplier:  Biotium
Description:   beta-2 microglobulin, Monoclonal antibody, Clone: BBM.1, Host: Mouse, Species reactivity: Human, Non-human primates, Isotype: IgG2b, kappa, Conjugate: CF543, Immunogen: MOLT-4 human T cell line, Synonyms: B2M, Beta 2 microglobin, Beta 2 microglobulin, Size: 500ul

Supplier:  Novus Biologicals
Description:   The beta-Glucuronidase / GUSB Antibody from Novus Biologicals is a rabbit polyclonal antibody to beta-Glucuronidase / GUSB. This antibody reacts with human. The beta-Glucuronidase / GUSB Antibody has been validated for the following applications: Western Blot.
Supplier:  Bioss
Description:   Beta Arrestin 1 is a member of a family of proteins that are widely expressed but especially abundant in the central nervous system. Serving as an adaptor or scaffold molecule, beta Arrestin 1 is essential for mitogenic signaling. It mediates agonist dependent desensitization and internalization of G protein coupled receptors (GPCRs, e.g., beta 2 adrenergic receptor). After binding to their ligand and interacting with heterotrimeric G proteins, GPCRs are phosphorylated by G protein receptor kinases (GRKs) on serine residues. Beta Arrestin 1 has important roles in the cytoplasm and at the plasma membrane in the desensitization and internalization of G protein coupled receptors (GPCRs) and is increasingly appreciated to play an important role in the endocytosis and signaling of GPCRs. Beta Arrestin 1 in the cytosol is phosphorylated by ERK1 and 2 on serine 412 in a negative feedback mechanism and binds to the phosphorylated receptors at the plasma membrane. Serine 412 is then dephosphorylated and the GPCRs are internalized, leading to activation of the Ras, Raf, ERK1 and 2 signaling pathway.
Catalog Number: (103007-216)

Supplier:  Anaspec Inc
Description:   This is amino acids 1 to 42 fragment of the beta-amyloid peptide, with lysine substituted for glutamic acid at position 22 found in Italian families with Alzheimer's disease. The Italian mutation of beta -amyloid 1 to 42 (E22K) aggregates more rapidly and with more potent neurotoxicity than wild-type beta-amyloid (1-42). The formation of a salt bridge between Lys22 and Asp23 in the minor conformer might be a reason why E22K is more pathogenic than wild-type beta-amyloid (1-42).
Sequence: DAEFRHDSGYEVHHQKLVFFAKDVGSNKGAIIGLMVGGVVIA
MW: 4513.1 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier:  Novus Biologicals
Description:   The Beta Lactamase Antibody from Novus Biologicals is a rabbit polyclonal antibody to Beta Lactamase. This antibody reacts with human, mouse, rat. The Beta Lactamase Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry / Immunofluorescence, Immunohistochemistry-Paraffin.
Catalog Number: (101215-260)

Supplier:  BioVendor
Description:   RELM-beta (Resistin-Like Molecule-beta) is a member of a recently identified family of secreted proteins containing a conserved cystein-rich C-terminus. The RELM family consists of resistin (also called FIZZ3), RELM-alpha (FIZZ1), RELM-beta (FIZZ2) and RELM-gamma. Only resisistin and RELM-beta were found in humans whereas all four RELM family members were identified in rodents. RELM-beta appears to be produced as a homodimer exclusively by intestinal goblet cells and can be found in high quantities in stool. Remarkably, stool of germ-free mice displaying sterile intestinal tract does not contain RELM-beta until bacterial colonization takes place after pathogen-free mice entered natural environment. Some, but not all, colon carcinoma cell lines secrete RELM-beta into the cell culture supernatant. The physiological function of RELM-beta is not known. High doses of recombinant RELM-beta showed hyperglycemic effects including lowered glucose disposal and increased hepatic glucose production in mice. Total 102 AA. MW: 11 kDa (calculated). UniProtKB acc.no. Q9BQ08. C-Terminal His-tag 12 AA
Supplier:  Anaspec Inc
Description:   This peptide is beta-amyloid (1-42) N-terminally truncated. It is the non-pyroglatamate form of beta-Amyloid (3-42). N-terminally truncated pyroglutamate-modified beta-Amyloid forms such as Aß(3-42) and Aß (11- 42) have been described as major compounds in the senile plaques. Pyro-Glu modified beta-Amyloid forms are more resistant to degradation, show higher toxicity and have increased aggregation propensity compared to non-modified beta-Amyloid.
Sequence: EFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 4327.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier:  Bioss
Description:   The cerebral and vascular plaques associated with Alzheimer's disease are mainly composed of Amyloid beta peptides. beta Amyloid is derived from cleavage of the Amyloid precursor protein and varies in length from 39 to 43 amino acids. beta Amyloid [1-40], beta Amyloid [1-42], and beta Amyloid [1-43] peptides result from cleavage of Amyloid precursor protein after residues 40, 42, and 43, respectively. The cleavage takes place by gamma-secretase during the last Amyloid precursor protein processing step. beta Amyloid [1-40], beta Amyloid [1-42], and beta Amyloid [1-43] peptides are major constituents of the plaques and tangles that occur in Alzheimer's disease. beta Amyloid and peptides have been developed as tools for elucidating the biology of Alzheimer's disease.
Supplier:  Bioss
Description:   Involved in embryogenesis and cell differentiation.
Supplier:  Rockland Immunochemical
Description:   Recombinant Mouse SDF-1 Beta/CXCL12 control protein
Catalog Number: (A-1540.0001BA)

Supplier:  Bachem Americas
Description:   Sequence: Boc-β-cyano-D-Ala-OH
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
2,529 - 2,544  of 33,994