Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

(R)-3-Amino-2-hydroxypropanoic+acid


163,908  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"163908"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Catalog Number: (103008-036)

Supplier:  Anaspec Inc
Description:   This peptide is Histone H3 amino acid residues 31 to 41 mono-methylated at Lys-36.
Sequence:STGGV-K(Me1)-KPHRY
MW:1243.4 Da
% peak area by HPLC:95
Storage condition:-20° C
Supplier:  AAT BIOQUEST INC
Description:   Oxaloacetate is an important part of citric acid cycle, where it reacts with Acetyl-CoA to form citrate.
Small Business Enterprise Minority or Woman-Owned Business Enterprise
Supplier:  THERMO FISHER SCIENTIFIC CHEMICALS
Description:   EDTA disodium salt dihydrate 99+% ACS
Catalog Number: (10455-764)

Supplier:  Bioss
Description:   This gene encodes a protein with limited similarity to L-amino acid oxidase which contains the conserved amino acids thought to be involved in catalysis and binding of flavin adenine dinucleotide (FAD) cofactor. The expression of this gene can be induced by interleukin 4 in B cells, however, expression of transcripts containing the first two exons of the upstream gene is found in other cell types. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Apr 2012].
Catalog Number: (103008-032)

Supplier:  Anaspec Inc
Description:   This peptide is Histone H3 amino acid residues 23 to 34 di-methylated at Lys-27.
Sequence:KAAR-K(Me2)-SAPATGG
MW:1142.3 Da
% peak area by HPLC:95
Storage condition:-20° C
Supplier:  Sino Biological
Description:   A DNA sequence encoding the amino acids (Met 1-Ala 189) of mouse KITL (P20826-1) was fused with a polyhistidine tag at the C-terminus.
Supplier:  TCI America
Description:   CAS Number: 18635-45-5
MDL Number: MFCD00012883
Molecular Formula: C3H8N2O2
Molecular Weight: 185.02
Purity/Analysis Method: >98.0% (T)
Form: Crystal
Melting point (°C): 230
MSDS SDS
Supplier:  Thermo Scientific Chemicals
Description:   1g CAS: 93-85-6, MDL: MFCD00054180
MSDS SDS
Supplier:  ALADDIN SCIENTIFIC
Description:   Heterobifunctional PEG derivative that can be used to modify proteins, peptides and other materials via amino or other acid reactive chemical groups. PEGylation can increase solubility and stability and reduce immunogenicity of peptides and proteins. It can also suppress the non-specific binding of charged molecules to the modified surfaces.
New Product
Supplier:  Thermo Scientific Chemicals
Description:   N(alpha)-Benzyloxycarbonyl-L-tryptophan Z-Trp-OH. Grade:99, Melting Point C124-126*. Boiling Point C:NA. C19H18N2O4. 7432-21-5. KEEP COLD
MSDS SDS
Supplier:  Matrix Scientific
Description:   MF=C17H27N3O2 MW=305.42 ,250Mg

Supplier:  Bioss
Description:   HGD is a 445 amino acid protein that belongs to the homogentisate dioxygenase family and is involved in the pathway of amino acid degradation. Expressed at high levels in kidney, colon, liver, prostate and small intestine, HGD uses iron as a cofactor to catalyze the oxygen-dependent conversion of homogentisate to 4-maleylacetoacetate, a reaction that is the fourth step in the creation of L-phenylalanine from fumarate and acetoacetic acid. Defects in the gene encoding HGD are the cause of alkaptonuria (AKU), an autosomal recessive disorder that is characterized by urine that turns dark on standing and alkalinization, black ochronotic pigmentation of cartilage and collagenous tissues and spine arthritis.

Supplier:  Bioss
Description:   HGD is a 445 amino acid protein that belongs to the homogentisate dioxygenase family and is involved in the pathway of amino acid degradation. Expressed at high levels in kidney, colon, liver, prostate and small intestine, HGD uses iron as a cofactor to catalyze the oxygen-dependent conversion of homogentisate to 4-maleylacetoacetate, a reaction that is the fourth step in the creation of L-phenylalanine from fumarate and acetoacetic acid. Defects in the gene encoding HGD are the cause of alkaptonuria (AKU), an autosomal recessive disorder that is characterized by urine that turns dark on standing and alkalinization, black ochronotic pigmentation of cartilage and collagenous tissues and spine arthritis.
Supplier:  REVACC INC
Description:   A recombinant form of the receptor binding domain (RBD with amino acids 319 to 541) of the spike (S) glycoprotein gene from severe acute respiratory syndrome-related coronavirus 2 (SARS-CoV-2), Wuhan-Hu-1 (GenBank: MN908947) was produced by human embryonic kidney HEK293F cells, followed by purification.

Supplier:  Anaspec Inc
Description:   A 36-amino acid Cl- channel blocker from Leiurus quinquestriatus scorpion venom.
Sequence:MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR-NH2 (Disulfide bridge: 2-19,5-28,16-33,20-35)
MW:3996 Da
% peak area by HPLC:95
Storage condition:-20° C
Supplier:  Chem Impex International
Description:   Chloromethyl polystyrene and styrene monomers are copolymerized in order to obtain the Merrifield resin. This method avoids the use of carcinogenic chloromethyl methyl ether. This resin is used in the synthesis of peptide acids using Boc strategy and can be cleaved using HF or TFMSA. Different Boc protected amino acids attached to this resin are also available from stock. Please inquire.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
7,297 - 7,312  of 163,908