Text Search >
(R)-3-Amino-2-hydroxypropanoic+acid
Print…
You Searched For:
164,173 results were found
(R)-3-Amino-2-hydroxypropanoic+acid
Catalog Number:
(10451-480)
Supplier:
Bioss
Description:
Required for the function of light chain amino-acid transporters. Involved in sodium-independent, high-affinity transport of large neutral amino acids such as phenylalanine, tyrosine, leucine, arginine and tryptophan. Involved in guiding and targeting of LAT1 and LAT2 to the plasma membrane. When associated with SLC7A6 or SLC7A7 acts as an arginine/glutamine exchanger, following an antiport mechanism for amino acid transport, influencing arginine release in exchange for extracellular amino acids. Plays a role in nitric oxide synthesis in human umbilical vein endothelial cells (HUVECs) via transport of L-arginine. Required for normal and neoplastic cell growth. When associated with SLC7A5/LAT1, is also involved in the transport of L-DOPA across the blood-brain barrier, and that of thyroid hormones triiodothyronine (T3) and thyroxine (T4) across the cell membrane in tissues such as placenta. Involved in the uptake of methylmercury (MeHg) when administered as the L-cysteine or D,L-homocysteine complexes, and hence plays a role in metal ion homeostasis and toxicity. When associated with SLC7A5 or SLC7A8, involved in the cellular activity of small molecular weight nitrosothiols, via the stereoselective transport of L-nitrosocysteine (L-CNSO) across the transmembrane. Together with ICAM1, regulates the transport activity LAT2 in polarized intestinal cells, by generating and delivering intracellular signals. When associated with SLC7A5, plays an important role in transporting L-leucine from the circulating blood to the retina across the inner blood-retinal barrier.
Catalog Number:
(103624-356)
Supplier:
Sino Biological
Description:
A DNA sequence encoding the human UBE2M (P61081) (Met 1-Lys 183) was expressed and purified, with additional two amino acids (Gly and Pro) at the N-terminus.
Supplier:
TCI America
Description:
N,N-Bis(4-Bromophenyl)-4-(4,4,5,5-Tetramethyl-1,3,2-Dioxaborolan-2-Yl)Aniline, Purity: >98.0%(HPLC)(T), Cas no: 850153-24-1, Molecular formula : C24H24BBr2NO2, Molecular weight : 529.08, Size: 1G
Supplier:
Anaspec Inc
Description:
PYY is a 36-amino acid regulatory gut hormone present in endocrine cells in the intestine. This peptide acts both as an endocrine and a paracrine agent.
Sequence:YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2 MW:4309.8 Da % peak area by HPLC:95 Storage condition:-20° C
Catalog Number:
(77555-102)
Supplier:
Sino Biological
Description:
The Chktide peptide sequence (KKKVSRSGLYRSPSMPENLNRPR) is based on the human CDC25C protein isoform A (amino acid 205-225).
Catalog Number:
(103664-976)
Supplier:
Sino Biological
Description:
A DNA sequence encoding the mouse CD48 (NP_031675.1) without the propeptide, corresponding to the amino acids (Met 1-Arg 216) was expressed with a C-terminal polyhistidine tag.
Catalog Number:
(101094-900)
Catalog Number:
(10072-762)
Supplier:
Prosci
Description:
Mature Myostatin is obtained by proteolytic processing of a biologically-inactive precursor protein, which contains an N-terminal propeptide of 243 amino acid residues. Myostatin Propeptide exhibits high binding affinity for myostatin and has been shown to be a potent inhibitor of Myostatin. Over-expression of myostatin propeptide in mice resulted in large increases (up to 200%) in skeletal muscle mass, similar to those observed in Myostatin knockout mice. Recombinant Human Myostatin Propeptide is a 27.8 kDa protein consisting of 244 amino acid residues.
Catalog Number:
(10334-152)
Supplier:
Bioss
Description:
Kallikrein 9, also known as Kallikrein-Like 3 (KLK-L3), is a chymotrypsin-like serine proteinase. Kallikrein 9 was discovered as the locus for kallikreins on chromosome 19 was more fully mapped and found by similarity to the other tissue kallikreins. Kallikrein 9 has been found in the ovary, thymus, testis, prostate, skin, breast and neuronal tissues and is made by many cell lines in culture. Kallikrein 9 levels in breast cancer and uterine cancer patients have been reported to drop as the disease progresses, thus hK9 might be considered a favorable prognostic marker. Different splice variants of hK9 have been reported, although it is not yet known if they produce functional proteins. The full length Kallikrein 9 encodes for a 250 amino acid protein, with a predicted mass of 27.5 kDa and a pI of 7.53. The 234 amino acid form predicts a protein of 26 kDa with a pI of 9.76 and this quite basic pI might give the shorter form a very different function or localization. The shorter sequence also diverges before the catalytic serine residue, making it unlikely to be proteolytically active. Pre-pro-kallikrein 9 has the 17 amino acid signal sequence is removed before secretion, and the Pro-kallikrein 9 is activated to Kallikrein 9 by removal of the 5 amino acid propeptide domain.
Catalog Number:
(103011-048)
Supplier:
Anaspec Inc
Description:
DABCYL is one of the most popular acceptors for developing FRET-based nucleic acid probes and protease substrates. DABCYL, SE is the amino-reactive form of DABCYL, and widely used to prepare a variety of FRET-based probes that contain DABCYL.
Supplier:
AMBEED, INC
Description:
H-Thr-OH, Purity: 97%, CAS Number: 72-19-5, Appearance: Form: Crystal - Powder, Storage: Keep in dark place, Inert atmosphere, Room temperature, Size: 1000G
Catalog Number:
(103008-180)
Supplier:
Anaspec Inc
Description:
This peptide is derived from Histone H3 21-44 amino acids, and is usually used as a substrate for methylation assays. It has been used as a substrate for protein arginine methyltransferases
Sequence:ATKAARKSAPATGGVKKPHRYRPG MW:2505.9 Da % peak area by HPLC:95 Storage condition:-20° C
Supplier:
Bachem Americas
Description:
Sequence: Fmoc-N-Me-Phe-OH
Supplier:
AMBEED, INC
Description:
3-Aminopicolinamide, Purity: 98%, CAS Number: 50608-99-6, Appearance: White to Pale-yellow to Yellow-brown Solid, Storage: Keep in dark place, Inert atmosphere, Room temperature, Size: 1g
Supplier:
MP Biomedicals
Description:
Lucifer Yellow CH is the hydrazine (-NH-CO-NH-NH2) form of the dye compared to Lucifer Yellow VS, which is the vinyl sulfone (-Ph-SO2-CH=CH2) form. It is a highly fluorescent dye useful in marking nerve cells.
Supplier:
TCI America
Description:
CAS Number: 4998-57-6
MDL Number: MFCD00005208 Molecular Formula: C6H9N3O2 Molecular Weight: 155.16 Purity/Analysis Method: >98.0% (HPLC,T) Form: Crystal Melting point (°C): 286
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
 is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
|
|||||||||
List View
