Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

2-Methoxyethyl+acetate


164,732  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"164732"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 


Supplier:  Bioss
Description:   The BTB (Broad-Complex, Tramtrack and Bric a brac) domain, also known as the POZ (Poxvirus and Zinc finger) domain, is an N-terminal homodimerization domain that contains multiple copies of kelch repeats and/or C2H2-type zinc fingers. Proteins that contain BTB domains are thought to be involved in transcriptional regulation via control of chromatin structure and function. ZBTB1 (zinc finger and BTB domain containing 1), also known as KIAA0997, is a 713 amino acid nuclear protein that contains one BTB (POZ) domain and 8 C2H2-type zinc fingers. ZBTB2 is a 514 amino acid nuclear protein that contains one BTB (POZ) domain and 4 C2H2-type zinc fingers. ZBTB25, also known as ZNF46 or KUP, is a 435 amino acid nuclear protein that is expressed mainly in hematopoietic cells and testis and contains one BTB (POZ) domain and 2 C2H2-type zinc fingers.
Supplier:  LGC STANDARDS
Description:   Acid Number, 2.5 mg KOH/g Certified Value, Paragon Scientific, LGC Standards
New Product
Catalog Number: (103009-746)

Supplier:  Anaspec Inc
Description:   TAU proteins belong to the microtubule-associated protein (MAP) family and are involved in the pathogenesis of Alzheimer’s disease. In the human brain, there are six TAU isoforms ranging from 352 to 441 amino acids in length. These isoforms vary at the carboxyl terminal according to the presence of either three repeat or four repeat domains (R1-R4), in addition to the presence or absence of one or two insert domains at the amino-terminus. Tau Peptide (337-368) is a 32-amino acid long peptide derived from the Repeat 4 domain.
Sequence:VEVKSEKLDFKDRVQSKIGSLDNITHVPGGGN
MW:3467.86 Da
% peak area by HPLC:95
Storage condition:-20° C
Catalog Number: (101215-404)

Supplier:  BioVendor
Description:   Resistin, a product of the RSTN gene, is a peptide hormone belonging to the class of cysteine-rich secreted proteins which is termed the RELM family, and is also described as ADSF (Adipose Tissue-Specific Secretory Factor) and FIZZ3 (Found in Inflammatory Zone). Human resistin contains 108 amino acids as a prepeptide, and its hydrofobic signal peptide is cleaved before its secretion. Resistin circulates in human blood as a dimeric protein consisting of two 92 amino acid polypeptides, which are disulfide-linked via Cys26. Resistin may be an important link between obesity and insulin resistance. Mouse resistin, specifically produced and secreted by adipocyte, acts on skeletal muscle myocytes, hepatocytes and adipocytes themselves so that it reduces their sensitivity to insulin.

Supplier:  Bioss
Description:   Cytochrome P450 proteins are heme-thiolate monooxygenases that mediate NADPH-dependent electron transport and function to oxidize a variety of structurally unrelated compounds, including steroids, fatty acids and xenobiotics. Specifically, Cytochrome P450s are responsible for metabolizing arachidonic acid to hydroxyeicosatetraenoic acid (a regulator of blood pressure) and epoxyeicosatrienoic acid (a molecule involved in signaling events). CYP20A1 (cytochrome P450, family 20, subfamily A, polypeptide 1), also known as CYP-M, is a 462 amino acid single-pass membrane protein that belongs to the cytochrome P450 family. CYP20A1 is thought to carry its own oxygen as it lacks a conserved I-helix motif and one amino acid of its conserved heme binding site.
Catalog Number: (10288-262)

Supplier:  Bioss
Description:   Cytochrome P450 proteins are heme-thiolate monooxygenases that mediate NADPH-dependent electron transport and function to oxidize a variety of structurally unrelated compounds, including steroids, fatty acids and xenobiotics. Specifically, Cytochrome P450s are responsible for metabolizing arachidonic acid to hydroxyeicosatetraenoic acid (a regulator of blood pressure) and epoxyeicosatrienoic acid (a molecule involved in signaling events). CYP20A1 (cytochrome P450, family 20, subfamily A, polypeptide 1), also known as CYP-M, is a 462 amino acid single-pass membrane protein that belongs to the cytochrome P450 family. CYP20A1 is thought to carry its own oxygen as it lacks a conserved I-helix motif and one amino acid of its conserved heme binding site.
Supplier:  REVACC INC
Description:   A recombinant form of the receptor binding domain (RBD) with amino acids 319 to 541) of the spike (S) glycoprotein gene from SARS-CoV-2 bearing mutations identified in variant of Omicron BA.4/5, was produced by insect cells, followed by purification.
Catalog Number: (89143-942)

Supplier:  Enzo Life Sciences
Description:   Isolated from stimulated human neutrophils. The secreted protein consists of 184 amino acids, six disulfide bonds and two glycosylation sites containing N-linked oligosaccharides.
Supplier:  BeanTown Chemical
Description:   CAS: 5704-04-1; EC No: 227-193-6; MDL No: MFCD00004277 Crystalline; Linear Formula: (HOCH2)3CNHCH2COOH; Molecular Formula: C6H13NO5; MW: 179.17 Melting Point: 187° (decomposes)
MSDS SDS

Supplier:  Bioss
Description:   Amisyn is a mostly cytosolic protein related to Tomosyn which plays an important role in SNARE complex assembly. Amisyn contains a v-SNARE coiled coil homology domain that binds to Syntaxin 1A and weakly to Syntaxin 4. Three isoforms exist for Amisyn. Isoform 1 is the full length protein, isoform 2 has a different amino acid sequence between residues 204-210 and isoform 3 is missing amino acids 1-102 and contains a different sequence for amino acids 103-150. Amisyn lacks a transmembrane domain and therefore is unable to assemble into a functional, membrane-anchored SNARE complex. This suggests that Amisyn may instead be acting to maintain SNARE conformation and facilitate the binding of VAMP-2. Amisyn can inhibit exocytosis independent of Syntaxin binding.
Supplier:  MilliporeSigma
Description:   (Gly). White crystalline solid. Purity: >99% by assay. Soluble in H2O. RTECS MB7600000, CAS 56-40-6, M.W. 75.1. WARNING! May be carcinogenic/teratogenic.
Supplier:  AMBEED, INC
Description:   3-[N-Tris(hydroxymethyl)methylamino]-2-hydroxypropanesulfonic Acid, Purity: 99%, CAS Number: 68399-81-5, Appearance: Form: Crystal - PowderColour: White - Almost white, Storage: Keep in dark place, Inert atmosphere, Room temperature, Size: 100G
Supplier:  Bioss
Description:   Excitatory Amino Acid Transporters (EAATs) are membrane-bound proteins that are localized in glial cells and pre-synaptic glutamatergic nerve endings. EAATs transport the excitatory neurotransmitters L-glutamate and D-aspartate, a process that is essential for terminating the postsynaptic action of glutamate. The re-uptake of amino acid neurotransmitters by EAAT proteins has been shown to protect neurons from excitotoxicity, which is caused by the accumulation of amino acid neurotransmitters. EAAT4 is an aspartate/glutamate transporter that is expressed predominantly in the cerebellum. The transport activity encoded by EAAT4 has high apparent affinity for L-aspartate and L-glutamate, and has a pharmacologic profile consistent with previously described cerebellar transport activities. EAAT5 is a glutamate transporter coupled to a chloride conductance which is expressed primarily in retina. Although EAAT5 shares the structural homologies of the EAAT family, a novel feature of the EAAT5 sequence is a carboxy-terminal motif previously identified in N-ethyl-D-aspartate receptors and potassium channels and shown to confer interactions with a family of synaptic proteins that promote ion channel clustering.

Supplier:  Bioss
Description:   Cytochrome P450 proteins are heme-thiolate monooxygenases that mediate NADPH-dependent electron transport and function to oxidize a variety of structurally unrelated compounds, including steroids, fatty acids and xenobiotics. Specifically, Cytochrome P450s are responsible for metabolizing arachidonic acid to hydroxyeicosatetraenoic acid (a regulator of blood pressure) and epoxyeicosatrienoic acid (a molecule involved in signaling events). CYP20A1 (cytochrome P450, family 20, subfamily A, polypeptide 1), also known as CYP-M, is a 462 amino acid single-pass membrane protein that belongs to the cytochrome P450 family. CYP20A1 is thought to carry its own oxygen as it lacks a conserved I-helix motif and one amino acid of its conserved heme binding site.

Supplier:  Thermo Scientific Chemicals
Description:   5G
MSDS SDS
Supplier:  HICHROM LIMITED
Description:   Avantor® Partisil® was one of the first commercially available irregular silicas. A large surface area gives it a high loading capacity.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
2,641 - 2,656  of 164,732