Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results


SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"33994"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 


Supplier:  AFG BIOSCIENCE LLC
Description:   Human Chorionic Gonadotrophin beta(beta-CG) ELISA Kit
Supplier:  R&D Systems
Description:   The Recombinant Human Active GSK-3 beta Protein from R&D Systems is derived from Sf 9 (baculovirus). The Recombinant Human Active GSK-3 beta Protein has been validated for the following applications: Bioactivity.
Supplier:  Anaspec Inc
Description:   This peptide corresponds to the CtoN inverted sequence of Beta-amyloid 40-1.
Sequence: VVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD
Molecular Weight: 4329.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Supplier:  Novus Biologicals
Description:   The Aspartate beta hydroxylase Antibody from Novus Biologicals is a rabbit polyclonal antibody to Aspartate beta hydroxylase. This antibody reacts with human. The Aspartate beta hydroxylase Antibody has been validated for the following applications: Western Blot.

Supplier:  R&D Systems
Description:   The Recombinant Human IFN-alpha/beta R2 Fc Chimera Protein from R&D Systems is derived from NS0. The Recombinant Human IFN-alpha/beta R2 Fc Chimera Protein has been validated for the following applications: Bioactivity.

Supplier:  ANTIBODIES.COM LLC
Description:   Rabbit polyclonal antibody to beta Catenin for Flow Cytometry, WB and IHC-P with samples derived from Human and Mouse.

Supplier:  Novus Biologicals
Description:   The 17 beta-HSD14 / HSD17B14 Antibody from Novus Biologicals is a mouse polyclonal antibody to 17 beta-HSD14 / HSD17B14. This antibody reacts with human. The 17 beta-HSD14 / HSD17B14 Antibody has been validated for the following applications: Western Blot, ELISA.
Catalog Number: (89262-528)

Supplier:  Genetex
Description:   Rabbit polyclonal antibody to Defensin beta 1

Supplier:  Bioss
Description:   Integrin alpha-4/beta-7 (Peyer patches-specific homing receptor LPAM-1) is involved in adhesive interactions of leukocytes. It is a receptor for fibronectin and recognizes one or more domains within the alternatively spliced CS-1 region of fibronectin. Integrin alpha-4/beta-7 is also a receptor for MADCAM1 and VCAM1. It recognizes the sequence L-D-T in MADCAM1. Integrin alpha-E/beta-7 is a receptor for E-cadherin.
Supplier:  AAT BIOQUEST INC
Description:   E. coli beta-galactosidase is a 464 kD tetramer.
Small Business Enterprise Minority or Woman-Owned Business Enterprise
Supplier:  Biotium
Description:   HCG-beta, Monoclonal antibody, Clone: hCGb/459, Host: Mouse, Species reactivity: Human, Isotype: IgG's, Conjugate: CF640R, Immunogen: Recombinant hCG beta protein (HCGb/54 and HCGb/459), Synonyms: CG-beta; CGB3; CGB5; CGB7; CGB8, Application: Immunofluorescence, Size: 100uL
Supplier:  Novus Biologicals
Description:   The beta 2-Microglobulin Antibody (246-E9.E7 (same as HLA.ABC.m2)) [DyLight 650] from Novus Biologicals is a mouse monoclonal antibody to beta 2-Microglobulin. This antibody reacts with human, primate (negative). The beta 2-Microglobulin Antibody (246-E9.E7 (same as HLA.ABC.m2)) [DyLight 650] has been validated for the following applications: Flow Cytometry.
Catalog Number: (103638-830)

Supplier:  Sino Biological
Description:   Produced in rabbits immunized with purified, recombinant Human IL1B / IL-1B / IL-1 beta (rh IL1B / IL-1B / IL-1 beta; Catalog#10139-HNAE; NP_000567.1; Ala117-Ser269). IL1B / IL-1B / IL-1 beta specific IgG was purified by Human IL1B / IL-1B / IL-1 beta affinity chromatography.

Supplier:  Novus Biologicals
Description:   The Proteasome 20S beta 6 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Proteasome 20S beta 6. This antibody reacts with human. The Proteasome 20S beta 6 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Supplier:  Biotium
Description:   Beta-catenin associates with the cytoplasmic portion of E-cadherin, which is necessary for the function of E-cadherin as an adhesion molecule. In normal tissues, beta-catenin is localized to the membrane of epithelial cells, consistent with its role in the cell adhesion complex. In breast ductal neoplasia, beta-catenin is usually localized in cellular membranes. However, in lobular neoplasia, a marked redistribution of beta-catenin throughout the cytoplasm results in a diffuse cytoplasmic pattern. Immuno-staining of beta-catenin and E-cadherin is helps in the accurate identification of ductal and lobular neoplasms, including a distinction between low-grade ductal carcinoma in situ (DCIS) and lobular carcinoma. Additionally, some rectal and gastric adenocarcinomas demonstrate diffuse cytoplasmic beta-catenin staining and a lack of membranous staining, mimicking the staining pattern observed with lobular breast carcinomas.

CF® dyes are Biotium's next-generation fluorescent dyes. CF®488A is a green fluorescent dye (Ex/Em 490/515 nm) with excellent brightness and photostability. The dye is minimally charged for less non-specific binding. CF®488A also is compatible with super-resolution imaging by TIRF.

Supplier:  Sino Biological
Description:   This antibody was obtained from a rabbit immunized with purified, recombinant Rat IL-1 beta (Catalog#80023-RNAE; Q63264-1; Val117-Ser268).
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
2,449 - 2,464  of 33,994