Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

(S)-(+)-2,2-Dimethylcyclopropanecarboxylic+acid


141,793  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"141793"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  MilliporeSigma
Description:   For molecular biology. DNase-, RNase-, and protease-free.
MSDS SDS
Supplier:  Thermo Scientific Chemicals
Description:   5g CAS: 196207-58-6, MDL: MFCD16294554
MSDS SDS
Catalog Number: (103007-214)

Supplier:  Anaspec Inc
Description:   This is amino acids 1 to 40 fragment of the beta-amyloid peptide with lysine substituted for glutamic acid at position 22, found in Italian families. The Italian mutation of beta-amyloid 1-40 (E22K) aggregates more rapidly and with more potent neurotoxicity than wild-type beta-amyloid 1-40. The formation of a salt bridge between Lys-22 and Asp-23 in the minor conformer might be a reason why E22K-beta-amyloid 40 is more pathogenic than wild-type beta-amyloid 40.
Sequence: DAEFRHDSGYEVHHQKLVFFAKDVGSNKGAIIGLMVGGVV
Molecular Weight: 4328.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Supplier:  Thermo Scientific Chemicals
Description:   50g CAS: 1572-98-1, MDL: MFCD00034667
MSDS SDS
Supplier:  THERMO FISHER SCIENTIFIC CHEMICALS
Description:   5,5'-Dithiobis(2-nitrobenzoic acid) (Ellmans reagent, DTNB) 99%
Supplier:  AMBEED, INC
Description:   1,2-Cyclohexylenedinitrilotetraacetic acid, Purity: 95%, CAS Number: 482-54-2, Appearance: White to off-white powder or crystals, Storage: Sealed in dry, Room Temperature, Size: 1G
Supplier:  Matrix Scientific
Description:   5,5'-Dithiobis(2-nitrobenzoic acid) (Ellmans reagent, DTNB) ≥97%
Supplier:  Thermo Scientific Chemicals
Description:   250mg CAS: 317802-08-7
MSDS SDS
Catalog Number: (77195-898)

Supplier:  AMBEED, INC
Description:   p-Toluic hydrazide, Purity: 98%, CAS Number: 3619-22-5, Appearance: Form: powder Colour: off-white to yellow, Storage: Keep in dark place, Inert atmosphere, Room temperature, Size: 250mg
Supplier:  AMBEED, INC
Description:   2,7-Bis(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-9,9-di-n-octylfluorene 97%
Supplier:  AMBEED, INC
Description:   1-Boc-4-(Aminomethyl)piperidine, Purity: 97%, CAS Number: 144222-22-0, Appearance: Colorless to pale-yellow liquid or solid, Storage: Keep in dark place, Sealed in dry, Room Temperature, Size: 100g
Supplier:  Rockland Immunochemical
Description:   Anti-KLH Antibody Peroxidase Conjugated antibody has been assayed against 1.0 µg of KLH in a standard capture ELISA using ABTS (2,2’-azino-bis-[3-ethylbenthiazoline-6-sulfonic acid])
Supplier:  Thermo Scientific Chemicals
Description:   2,3-O-Isopropylidene-D-ribonic acid-1,4-lactone, 97+%. Powder.
MSDS SDS
Supplier:  AMBEED, INC
Description:   trans-1,2-Diaminocyclohexane-N,N,N',N'-tetraacetic acid (CDTA) 98%
New Product
Supplier:  Rockland Immunochemical
Description:   Anti-Catalase has been assayed against 1.0 µg of Catalase (Bovine Liver) in a standard capture ELISA using ABTS (2,2’-azino-bis-[3-ethylbenthiazoline-6-sulfonic acid])
Supplier:  BeanTown Chemical
Description:   CAS: 124752-23-4 Solid; Molecular Formula: C13H22O5; MW: 258.31
MSDS SDS
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
1,105 - 1,120  of 141,793
Prev   70  71  72  73  74  75  76  77  78  79  80  81  82  83  84  85  Next